KEGG   Sinorhizobium meliloti BL225C: SinmeB_4379Help
Entry
SinmeB_4379       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, LacI family
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 Peripla_BP_4 HTH_3 HTH_31 TetR_N HTH_24 YdaS_antitoxin HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AEG08661
UniProt: A0A0E0UPV2
Position
pSINMEB02:complement(1000427..1001422)
Genome map
AA seq 331 aa AA seqDB search
MARSTIVELAKAAGVSPTTVSHAFSGRRYVDPETKARIVALADKMGYRANPRARRLRTGG
AGIIALASSMPFAVAAGPARLGFLMEIAAAAAVTALSRHLALCLVPPLEPDSNLDALEVD
GAIIVEPMVEDRLLDFFSARGVPVVSIGRAPGREDIPSVDIQSTATARLMLEHLGANSRR
VGLITGEQRRNSYIETEAAYAAFAAERGYSPVALRVDESGGESEAAAAAERLLRNNPDID
ALCVPVDAFARGVLDAARLLDRPVPHGLRLATRYDGMRAKLATPQLTAVNLHLDQVAEAA
IDLLIAAMEGKEPQPHAIAPPQLVVRESSAA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatcgacgatcgtggaattggcgaaggcggcgggcgtatcgccgaccacggtt
tcccacgccttcagcggacggcgctatgtcgaccccgagacgaaagccagaatcgtagcg
ctggccgacaagatgggctaccgggccaatccccgggcccgcaggctccggacgggcggg
gcggggatcatcgccctggcatcgtcaatgccctttgcagtcgctgcaggccctgcgaga
ctgggcttcctgatggagatcgctgccgccgctgccgttacggcgctttcgcggcatctc
gccctctgcctggtgccgcctttggagcccgactccaacctcgacgcgctggaagtcgac
ggcgccataatcgtcgaacccatggtcgaagaccgcttactggatttcttctccgcccgc
ggcgtacccgttgtctcgatcggacgggcgccggggagggaggacattccgtcggtggat
atccagagcactgcgacggcccggctgatgctggagcaccttggcgcgaacagccgccgc
gtcggcctgatcaccggcgagcagcggcgcaattcctatatcgagaccgaagcagcctat
gcggctttcgccgcggagagaggatattcaccggtggcgttgcgcgtcgacgaaagcggc
ggcgaatccgaagcagccgcggctgccgaaaggctcctgcgaaacaatccggatatcgac
gcgttatgcgtgcctgtcgacgctttcgccaggggcgtgctcgatgccgcccggttgctc
gaccgtcccgttccgcatgggctacgactggcgacgcgatacgacgggatgcgggcaaaa
ctcgcgacgccgcaattgacggctgtcaacctgcacctggatcaggtcgcggaagcggcg
atcgacctgctgatcgcagcgatggagggcaaggagccccagccgcacgcgatcgccccg
ccgcaacttgtcgtgcgggaatcctcggcggcatga

DBGET integrated database retrieval system