KEGG   Sinorhizobium meliloti BL225C: SinmeB_4380Help
Entry
SinmeB_4380       CDS       T01884                                 

Definition
(GenBank) Xanthine/uracil/vitamin C permease
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease UPF0182
Motif
Other DBs
NCBI-ProteinID: AEG08662
UniProt: A0A0E0UPS4
Position
pSINMEB02:1001575..1002924
Genome map
AA seq 449 aa AA seqDB search
MTGNKIDSIDPTDEVLPPRSLVLFGLQHVLVMAASPITAVFLVSKALGFSDALTVSLISA
TFLICGLGTILQSFGPAGFGARLPFIMVPGGAPIAIFLAIAQQTDVQTAVGAVILTAGFY
FLALPVFRRLLRYFPPIVVGTMLLLVSVNLVRIYGGTITGKQGSEGFADPMNVGLALATI
ALTVIFARVFTGTLQRISVMLGLIAGSAIAIGAGYMDLSGIFDGPVIAMPQLLPFGMPKF
DFFAALPLIVFSIISMAEATGQTIATAEIVGRRGDAHAIVPATIRGDAVASLVGGLFGTS
LIITSGENVGIVRATNVKSRYVTATAGVILVLIALFAPIGRLANALPGPVVGGTAVIVFS
IIGVIGIDLLRRVDLREHGPMFTLAAALSMGLLPILVPGVYSQFPQWSQMILANGLAAGT
ITAVIVNAFFQHLPLEQFQEKCAAVFRPE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggaacaaaatcgattctatcgacccgacggacgaagtgctgccgccgcgcagc
ctggttctgttcggtcttcagcatgtgctggtgatggctgcttcgccgattaccgccgta
tttctcgtaagcaaggcgctcgggttttccgacgctctgacggtatcgctgatcagcgcg
acatttctgatctgcggactgggcaccatcctgcagagtttcgggccggctggcttcggc
gcgcggctgccgttcatcatggtgccgggtggcgctccgatcgcgatctttctggccatc
gcccagcagaccgacgtgcagacggccgtcggcgcggtgatcctcacggcaggcttctac
ttcctggcgctgccggtattccggcggctgctgcgctattttccgcccatcgtggtcggg
acgatgctccttctcgtatcggtaaacctcgtgcgcatctacggcggcacgatcaccggc
aagcaggggagcgagggcttcgccgatccgatgaatgtcgggcttgcccttgcgacgatc
gcgctgacggtgatcttcgcgagagtcttcacgggcacgcttcagcggatctcggtgatg
ctcggcctcatcgcgggttcggccatcgccatcggagccgggtatatggacctttccggc
atcttcgacggaccggtgattgccatgccccagcttcttccgttcggaatgccgaagttc
gactttttcgccgcccttccgctgatcgtgttttcgatcatatcgatggccgaagcgacg
gggcagaccatcgccacggccgagatcgtcgggcgtcggggcgacgctcacgcgatcgtg
cccgcaacgatccgcggcgacgccgtcgcctcgctcgtcggcggcctgttcggaacctcg
cttatcatcaccagcggtgaaaacgtgggtatcgtccgggcaaccaacgtcaagtcccgc
tacgtcaccgcaacggccggcgtgatcctcgtcctcatagccctgtttgcgccgatcggt
cgtttggcgaatgccctgcccggccccgtcgtcggtggaacggccgtgatcgtgttctcg
atcatcggcgtgatcgggatcgatcttctgcgtcgcgtcgatctgcgcgagcacggcccg
atgttcaccctggcagcggcgctttccatggggctactgccgatcctggtcccgggcgtc
tacagccagtttccgcaatggagccagatgatcctggcgaacggccttgccgccggaacc
atcacggcggtgattgtgaacgcgttttttcaacacctgcctctagagcaattccaggaa
aagtgcgcagcggttttccgtccggaatag

DBGET integrated database retrieval system