KEGG   Sinorhizobium meliloti BL225C: SinmeB_4393Help
Entry
SinmeB_4393       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, RpiR family
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS HTH_6 SIS_2
Motif
Other DBs
NCBI-ProteinID: AEG08675
UniProt: A0A0E0UQR7
Position
pSINMEB02:complement(1015852..1016742)
Genome map
AA seq 296 aa AA seqDB search
MDKGPLSDAIITAFDGLSSQLRTAARYIVDHPRDVALLSMREQARQAGVQPATMTRLAKQ
LGFDGYDAIRERYAEALREGDAGFAGKAGEQARSQKLRGDHALAADMLRTIGTQISRLAE
PAALDRIVAAATRLARARRVYCLGLRSSHAVAWQFHYILSLVGEKSVMLDGIGGTGADAV
GRATSADVLLVASVLPYTRATIEIAEYARDNGVPVVAVTDSEVAPLAQIAEAIIVVPTES
PSFLHAMAPAFAVAEALGALIAGRGGEATLAALERFDGQLAALNTHLQSRNSKRAP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggggccgctcagcgacgcgatcatcaccgccttcgacgggctttcgtcgcaa
ttgcggacggcggcccgctatatcgtcgaccatccccgcgacgtcgctcttctctccatg
cgcgagcaggcgcgccaggcgggggtgcagcccgcgacgatgacccgccttgccaagcaa
ctcggtttcgatggttacgatgccatccgcgaacgttatgccgaggcgttgcgggagggt
gatgccggatttgccggaaaggccggcgagcaggcccgaagccagaagctgaggggcgac
cacgcgctcgccgccgatatgttgcgcacgatcgggacgcagatttcgcggctcgcagaa
ccggctgcgctcgatcgcatcgttgcagcggccacgcggcttgcccgtgcccggcgggtc
tactgcctcgggctgcgctcgagccacgcggtcgcctggcagttccactatattctttcg
ctggtcggcgaaaaatccgtgatgctggacggcatcggcggcaccggcgcggatgccgtc
ggacgtgccacgagcgcagacgtgctgctcgtggccagcgttcttccctatacacgggcg
acgatcgaaattgccgaatatgctcgggacaacggcgtaccggtcgtcgcggtgaccgac
agcgaagtggcgccgcttgcgcagatcgccgaggcgatcatcgtcgtgccgaccgaaagt
ccttccttcctgcacgccatggcgcccgcctttgccgtcgccgaagcgctaggcgcgctc
atcgcaggccggggcggcgaagcgacgctcgcggctctggagcgcttcgacgggcagctc
gcggcgctgaacactcatctccaatcccgcaactccaagagagcgccatga

DBGET integrated database retrieval system