KEGG   Sinorhizobium meliloti BL225C: SinmeB_4396Help
Entry
SinmeB_4396       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEG08678
UniProt: A0A0E0UQE0
Position
pSINMEB02:1018072..1018254
Genome map
AA seq 60 aa AA seqDB search
MTPDPIGPGPGPGIIPPNPVPPLGIPDPPPNEPQPDKGPEDDSQNPPGEKDPPRTDVLPR
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgatccgatcggccccggccccgggccgggaataattccgccgaacccggtt
ccgccactcggcattcccgatccgccgccaaacgagccccagcccgacaagggtcccgag
gacgactcgcagaacccgcccggcgaaaaggacccgccccggaccgacgtgctcccccgg
tga

DBGET integrated database retrieval system