KEGG   Sinorhizobium meliloti BL225C: SinmeB_4397Help
Entry
SinmeB_4397       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEG08679
UniProt: A0A0E0UQ11
Position
pSINMEB02:1018313..1018498
Genome map
AA seq 61 aa AA seqDB search
MTHAEEVIERAMAAVAQARRRREREQEWRRKTFGRIQVGIPLPPLKRGVQLSLQLDRPST
Q
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgcagaggaagttatcgagcgcgccatggccgccgtcgcccaggcaagacgc
cggcgggagcgcgaacaggagtggcgcagaaaaaccttcggacggattcaggtcggtata
ccgctcccgcccctcaagcgcggcgtgcagctttcgctgcagcttgaccgccccagtacg
caatga

DBGET integrated database retrieval system