KEGG   Sinorhizobium meliloti BL225C: SinmeB_4398Help
Entry
SinmeB_4398       CDS       T01884                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_4
Motif
Other DBs
NCBI-ProteinID: AEG08680
UniProt: A0A0E0UQS2
Position
pSINMEB02:complement(1018571..1019779)
Genome map
AA seq 402 aa AA seqDB search
MIDAHYRWVIVAAGGLLGCIAIGAMFSLPVFLVPISRDTGWSVTGISSAMTVGFIAMALA
SMVWGSASDRWGPRPVVLIGSALLAASLALSSLVTSLIAFQLVFGVVVGGACAAIFAPMM
ACVTGWFDTHRSLAVSLVSAGMGMAPMTMSPLAGWLVTIYDWRTSLQIIAALAAVTMIPA
ALLLRRPPVLEDTNAVSASEGQPDMSLGQALRSPQFVILLLTNFFCCATHSGPIFHTVSY
AVSCGIPMMAAVSIYSLEGLAGMGGRVAFGVLGDRYGAKRILVSGLLLQAFGALAYFFVR
DLGAFYAVAAVFGFIYAGVMPLYAVIARENFPLRMMGTVIGGTAMAGSLGMAIGPVAGGL
IYDVFASYGWLYIGAWGLGIGAFLIALTFKPFPRERPALAAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgcgcattatcgctgggtgatcgttgctgccggcggcctgctcggctgcatt
gcaatcggtgccatgttttcattgccggttttccttgtgcccatctcgcgcgataccgga
tggtcggtgaccggtatatcgagtgccatgacggtgggcttcatcgcaatggccctggca
agtatggtctggggtagcgcttcggaccgctggggcccgcgcccggtcgtgctgatcggt
tccgcgcttcttgcggcgagcctggcgctttccagcctcgtgacatcgctgatcgcattc
cagctcgtcttcggggtggtcgtcgggggggcctgtgcggcgatattcgcaccgatgatg
gcttgcgtgacaggctggttcgatacgcatcgcagccttgccgtatctctggtgtcggcc
ggcatgggaatggcacccatgaccatgtcgccgttggccgggtggctggttacgatctac
gactggcggacatcgctgcagatcatagccgcccttgccgccgtcacgatgattccggct
gcgttgctgctgcgccgcccgccggtcctcgaagatacaaatgccgtctccgcaagcgaa
gggcagccggacatgtcccttggacaggcgctgagatcgccccaattcgtcatattgctg
ctgacgaacttcttttgctgcgccacccattccgggccgattttccacacggtgagctac
gccgtgagctgcgggatcccgatgatggccgccgtttccatctacagcctcgagggtctg
gcgggaatgggcggccgcgtcgccttcggcgtcctcggagaccgctacggcgccaagcgc
attctggtatcggggctgctgctgcaggccttcggtgcgctcgcctatttcttcgtgcgc
gatctcggcgccttctacgcggtggctgccgtgttcggcttcatctatgcgggcgtcatg
ccgctttacgccgtgatcgcccgcgagaatttcccgctgcgcatgatgggcactgtcatc
ggcggcacggcaatggccggcagcctcggcatggcaatcggcccggttgccgggggactg
atctacgacgtttttgccagctacggctggctctatatcggcgcctggggtctcggcatc
ggtgctttcctgatcgcactgaccttcaagcccttccctagggaacggccggcactggct
gccgcctaa

DBGET integrated database retrieval system