KEGG   Sinorhizobium meliloti BL225C: SinmeB_4532
Entry
SinmeB_4532       CDS       T01884                                 

Definition
(GenBank) Xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00230  Purine metabolism
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SinmeB_4532
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SinmeB_4532
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AEG08814
UniProt: A0A0E0UQE3
Position
pSINMEB02:complement(1150895..1153213)
AA seq 772 aa
MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALPGMLHAKMKRSNIAHA
RIRSIDTSKALALKGVKAVLTHENVPRVLHAGSPHPRSASVTKDQYILDDRVRYWGEGVA
AVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHENGLDRNQVLPPVFVTRG
NVDGGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTGRPVKMEFSRKETFLGGRSR
HPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGC
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVREGDIAPSGHPI
VGHGLGDCIRRVMEETNWHGLRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDIVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPMLKAEPENLAIRDGFVVVTNGSNRSIRLSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLEVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIILETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYPITPEQVLNALKSKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacatatgaaaggatcgatagagacctgtccgaccgggacttcaccgtcgtgggc
aagagcgtcaagcgttccgatactctggagaaggtcacggggacggccagatatgcaggc
gacgtcgccttgcccggcatgctccacgccaagatgaagcgcagcaacatcgcgcatgcg
cgcatcaggagcatcgacacgagcaaggcgctggcgctcaagggcgtcaaggcggtgctg
acgcacgagaacgtgccgcgcgttttgcatgcgggctcaccgcatccgcgctcggcatcg
gttaccaaggatcagtacatcctggatgacagggtgcgatattggggcgagggcgtcgcc
gcagtcgctgccgtcagcgaggaaatcgctgagcgcgcggtcgcgctcatcgaggtcgag
tacgagcccttgcccggcctcttcacaatcgaagccgcatcggtgcccggcgccccgccg
atccatgagaatggtctcgaccggaaccaggtgttgccgccggtcttcgtcacccgcggc
aacgtcgacgggggtttcgccgaagcggatctgatcctcgagcgcgaatacgatctcgga
cgcccgacaccggcctatatggagcccaatgtctgtgtcagccagtgggacggcaacggc
aagctcaccatgtggacctcgacccagagcgcattcatggtccgcggcacgcttgccgaa
gtgctcggcgtgccgctgaacaaggtacgcgttatcgtcgatcacatgggcggcggcttc
ggcgcgaagcaggatctgtttcagaacgagttcctctgcgccctgctcgcgcgacagacg
gggcgtcctgtcaagatggagttcagccgcaaggaaacgttcctcggcggccgctcgcga
caccccggcaagatatggctgaagcagggcttcaccaaagacggccggatcgtcgcacgc
gaagccagggtcaccttcaactccggcgcctacggctcgcacggtccaggcgtcaccaat
gtcggcaccgcagcgctgacctcgctctaccgttgcgagaatgtccggctggaaggctgc
tgcatctataccaattcgccgatcgccggcgcctttcgcggctatggtgtggttcagacc
tactatgcgctcgacctcatgatggacgaggcggccgagaagctcggcttcgacccggcc
gagttcaagttgatgaacgcggtgcgcgagggcgacatcgcaccctccgggcatccgatc
gtcggacacggcctcggggattgcatccgccgcgtcatggaggagacgaactggcacgga
ttgcgcaggcgggagaagccggaaaccgtcaagcgccgcgggatcgggatcggctgcgaa
atgcacggatccagtgcctatccgggcatcaaggaacagggcaacgcaatcgtgaagatg
aacgaggacggaacggtgacactgatcaccggcaccgccggcctcggcaccggcgcgcat
acggccctttcgcagatcgtcgccgaggaactcggcgtgcccttcgaagccgtctcggtc
gttcaaggggacaccgatatcgtcccctgggatatcggtgccttcgccagccacacgacc
tatctcggcggacgggcggctcagctcgcggccgccgacgtgcgcagacaagtgctcgaa
cacgccgcgcccatgctcaaggccgagcccgagaatctcgcgatccgggacggtttcgtg
gtcgtcaccaacggctccaaccgcagcatccggctttccgaggccgtcgggccgcaacgg
gggatgccggcggtgcaactggtcggcgtaggcacctacatgccgacgaagtcctactcc
ttcgccgcccatttcgccgaagtcgaggtggacaccgagaccggcgaggtggccgttctc
gaggtcgttccggtacatgagatcggcagggtcatccatccgatcgccgcggccggacaa
atcgagggtggcattcagcagggcatcggccacaccctcagcgaggattacgtcatcgac
cttaccgatggccgttccctcaatccgagcttcgtcgattacaagatgcccctgtcgatg
gacatgccgtccatccgcaccatcatcctcgagacggcaccggatcccggcggtccctac
ggtgccaagggcgtcggcgaggatccgatcatcgcgatcgggcccgccatcgccaacgcc
atctacgacgccatcggcgtccgcttccaccactacccgataacgcccgagcaggtgttg
aacgctctcaagtccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system