KEGG   Sinorhizobium meliloti BL225C: SinmeB_4673Help
Entry
SinmeB_4673       CDS       T01884                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00052  Galactose metabolism
smq00561  Glycerolipid metabolism
smq00600  Sphingolipid metabolism
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SinmeB_4673
  Lipid metabolism
   00561 Glycerolipid metabolism
    SinmeB_4673
   00600 Sphingolipid metabolism
    SinmeB_4673
Enzymes [BR:smq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SinmeB_4673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEG08948
UniProt: A0A0E0UR43
Position
pSINMEB02:1304397..1305869
Genome map
AA seq 490 aa AA seqDB search
MASFKIAIIGAGSIGFTKKLFTDILSVPELRDVEFALTDLSEHNLAMIKSILDRIVEANE
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGARDGELDYICSGINHQTWFVDVRLNGRKVGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEISRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLETIRRSNEHASRILEALETGRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVAGITLPEACAATCISSVNVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAKWLPQYAHAIDAAKERLARATVATREWKGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcaagatcgccatcatcggcgccggcagcatcggcttcaccaagaagctc
ttcaccgacattctttccgtgccggagctccgggacgtcgagttcgcgttgacggatctg
agcgagcacaacctcgccatgatcaagtccatcctcgaccggatcgtcgaggcgaacgaa
ctgcccacgcgggtgacggcgacgaccgaccgccgcaaggcgctggaaggcgcacgctac
atcatcagctgtgtgcgcgtcggcggcctcgaggcctatgccgacgatattcgcattcca
ttgaagtacggcgtcgaccaatgcgtcggcgacacgatctgcgccggcgggatcctctac
ggccagcgaaacattccggtgatcctggatttttgcaaggacattcgcgaggtggcggag
cccggcgccaagttcctcaactatgccaacccgatggcgatgaacacctgggcggcgatc
gaatacggcaaggtcgacacggtcggtctctgccacggcgtccagcacggggccgagcag
atcgccgaaattctcggcgccagggacggggagctcgactacatctgctccggcatcaac
caccagacatggttcgtcgatgtccgtctcaacggccgcaaggtcggcaaggacgaactc
gtcgccgccttcgaggcgcatccggtcttttccaagcaggagaagctccggatcgacgta
ttgaagcgcttcggcgtctattcgaccgaaagcaacggacatctgtccgaatacctgccc
tggtaccgcaagcgtccggacgagatctccagatggatcgacatgtccgactggatccac
ggggagaccggcgggtatctccgctattcgaccgagacccgcaactggttcgagaccgaa
tatccgcgcttcctcgaagaggcgggccggccgctggaaacgatcaggcgctcgaacgaa
catgcgagccgcatcctcgaagcgctcgagacgggtcgggtctatcgcggccacttcaac
gtcaagaacaacggcgtgatcaccaacctgccggcagatgcgatcatcgaatcccccggc
ttcgtcgatcggttcggcatcaacatggtggcaggcatcacgttgccggaggcctgtgcg
gccacctgcatctcgtcggtcaacgtccagcgcatgtccgttcatgcggcgatcaccggc
gacatcgatctcctgaagctcgcggtgctgcacgacccgctggtcggcgccatctgcacg
ccggaggaagtctggcagatggtcgacgaaatggtggtcgcgcaggccaaatggctgccg
caatatgcccatgcgatcgacgcggccaaggaaaggctcgcccgcgccacggtcgccacc
cgggagtggaagggcgccgcgcgtcgcgaggtgcgctcgatcgaggagatccgagcggag
aaggaagcggcgaagctgcgcgctgcggggtag

DBGET integrated database retrieval system