KEGG   Sinorhizobium meliloti BL225C: SinmeB_4783Help
Entry
SinmeB_4783       CDS       T01884                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00071  Fatty acid degradation
smq00280  Valine, leucine and isoleucine degradation
smq00281  Geraniol degradation
smq00310  Lysine degradation
smq00360  Phenylalanine metabolism
smq00362  Benzoate degradation
smq00380  Tryptophan metabolism
smq00410  beta-Alanine metabolism
smq00627  Aminobenzoate degradation
smq00640  Propanoate metabolism
smq00650  Butanoate metabolism
smq00903  Limonene and pinene degradation
smq00930  Caprolactam degradation
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
smq01130  Biosynthesis of antibiotics
smq01212  Fatty acid metabolism
Module
smq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SinmeB_4783
   00650 Butanoate metabolism
    SinmeB_4783
  Lipid metabolism
   00071 Fatty acid degradation
    SinmeB_4783
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SinmeB_4783
   00310 Lysine degradation
    SinmeB_4783
   00360 Phenylalanine metabolism
    SinmeB_4783
   00380 Tryptophan metabolism
    SinmeB_4783
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SinmeB_4783
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SinmeB_4783
   00281 Geraniol degradation
    SinmeB_4783
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SinmeB_4783
   00627 Aminobenzoate degradation
    SinmeB_4783
   00930 Caprolactam degradation
    SinmeB_4783
Enzymes [BR:smq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SinmeB_4783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AEG09058
UniProt: A0A0E0URI7
Position
pSINMEB02:1434579..1435649
Genome map
AA seq 356 aa AA seqDB search
MEMQTTLPEVIVERQGAIGRLRLNRPRALNSLNRTMIRAIAAALTEFERDPEIAAVLVTG
EGERGLCAGGDIRMIYESGRERPGEGAQFWREEFIVNSRISAYSKPYIAIMDGIVMGGGV
GVSSHGSHRVVTERTRFAMPETGIGYFTDVGATWLLPRAPGEFGTYLGLTGRDIGAAAVI
HARLADSFVPSEMIGELLGALSSLSGSATADDVSAAIRAVSSEPPASALLDHLFVIDRCF
AFNAVEEIFAALEKDESDFARETLELLKTRSAISLKLTLSLLRAGRSSATLNECLEREYA
ATLGMLSNPDFYEGVRAAVIDKDRNPKWSVGLSEVTPELLARFGRNDGAPLFAGKE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcagaccacgcttccggaggtcattgtcgagcgccagggcgcgatcggcagg
ctgcggctcaaccgtccgcgcgcactgaatagcctcaatcgcacgatgatccgcgcgatc
gctgcggcgctgaccgaattcgagcgcgacccggagattgccgcagtgcttgtcacgggc
gagggcgaacggggcctctgcgccggcggcgacatccggatgatatacgaaagcggccgc
gagcggcctggggaaggtgcgcagttctggcgcgaggagttcatcgtcaacagccgaatt
tcagcctactccaagccctatatcgcgatcatggacgggatcgtgatgggcggcggcgtc
ggcgtttcctcccatggcagccatcgggtcgtgaccgagaggacgcgctttgccatgccg
gaaacggggatcggctatttcaccgatgtcggcgcgacctggctcctgccgcgcgcgccc
ggcgagttcggtacctatctcgggctgacgggccgcgatatcggtgcggcggcggtcatc
catgcgcggctcgccgacagtttcgttccctccgagatgattggcgagctcctcggcgcg
ctctcctcgctttccggttcggccaccgccgatgacgtttcggcggcgatccgcgccgtt
tcgagcgagcccccggcatcggccctgctggaccacctgttcgtcatcgaccgttgcttc
gccttcaatgccgtggaggagatcttcgcggcgctggagaaggacgagtcggatttcgcg
cgcgagacgctcgaactcctgaagacccgatcggcgatcagcctcaagctgacgctgtcg
ctcttaagggcagggcgctccagcgcaacgctcaacgaatgcctcgagcgggaatatgcc
gcgaccctcggcatgctttccaatccggatttctacgagggcgtcagggccgcggtgatc
gacaaggaccggaatccgaaatggtcggtcgggctttcggaagttacccccgagctgctc
gcccgtttcgggaggaatgacggcgcgccgctcttcgccgggaaggaataa

DBGET integrated database retrieval system