KEGG   Sinorhizobium meliloti BL225C: SinmeB_6484Help
Entry
SinmeB_6484       CDS       T01884                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:smq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SinmeB_6484
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SinmeB_6484
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SinmeB_6484
    1.1.1.-  
     SinmeB_6484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Exo_endo_phos ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEG07591
UniProt: A0A0E0ULU4
Position
pSINMEB01:complement(1391525..1392538)
Genome map
AA seq 337 aa AA seqDB search
MKAVRLYGAMDLRVGEVAEPSAPPPGFVNLEVRAAGICGSDLHNYRTGQWISRRPSTAGH
EFCGRVTAIGEGVSHVVRGDVVSADSRMWCGTCPACTSGRSNVCETLGFVGEICDGGFAE
AVQLPARLVVRHDPQLSPHVAAMAEPLAVALHAVRRLAIPAGEPVLVIGCGTIGGLSALL
LSRLHDGPLLLGDLNADKAALVAEVTGGAVVALDRAVVEAALSGGRVRYALDATGSIQAI
ARALDILSGGGALALVGIGHGKLDFDPNIIVEREISLVGCHAFAGELPEAIELLADLAPA
LQRFIEVLPTLDDVPEAYERLLRGESNALKTIIEVAG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtgcggctttacggcgccatggatttgcgggtgggagaggtcgccgaaccg
tcggctccgccgccgggcttcgtcaaccttgaagtaagggctgctggcatctgcggttcc
gaccttcacaactaccgtaccggccaatggatctcgcgccggccctcgacggcaggccat
gaattctgcggtcgcgtgactgcgatcggagagggcgtcagtcacgtggtgcggggagac
gtcgtctcggcggactcacgcatgtggtgcggcacttgcccggcttgtacgagcggccgc
agcaatgtctgcgagaccttgggcttcgtcggcgagatttgtgacggcggctttgccgag
gcagtgcaattgccagcccgactggtcgtgcgccacgatccgcagctttcgccccatgtt
gccgccatggccgagccgctggcagtggccttgcatgccgtacgtcgccttgccattccg
gccggcgaaccggtcctcgtcatcggctgcggcacgatcggtgggttgagcgcgcttctt
ctgtcccggctgcatgatggtccgctgctgctcggcgatctgaacgccgacaaagccgcc
cttgtcgctgaggtgactggcggcgcggtcgttgctcttgacagggcggtggtcgaggcc
gcgctttccggcggaagggtgcgctatgcactggatgccaccggcagcatccaggcgatc
gcccgagctctcgacattctgtcaggcggcggagcgctggcgctcgtcggcatcggccac
ggcaagctcgatttcgatccgaacatcatagtggagcgggagatatcgctcgtcggctgt
catgcctttgcgggcgagttgcccgaggccatcgaattgctcgccgatctggcgccggcg
ctgcaacgtttcattgaggtgctgccgacgctcgacgatgtgccggaagcttatgaaagg
ctgctgcgaggcgagagcaatgcgctcaagacgatcatcgaggtggcgggctga

DBGET integrated database retrieval system