KEGG   Staphylothermus marinus: Smar_0470Help
Entry
Smar_0470         CDS       T00485                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smr  Staphylothermus marinus
Pathway
smr00020  Citrate cycle (TCA cycle)
smr00640  Propanoate metabolism
smr00720  Carbon fixation pathways in prokaryotes
smr01100  Metabolic pathways
smr01110  Biosynthesis of secondary metabolites
smr01120  Microbial metabolism in diverse environments
smr01130  Biosynthesis of antibiotics
smr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smar_0470
   00640 Propanoate metabolism
    Smar_0470
   00660 C5-Branched dibasic acid metabolism
    Smar_0470
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Smar_0470
Enzymes [BR:smr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Smar_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A NAD_binding_10 Peripla_BP_4 CPSase_L_D2 ATP-grasp Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABN69579
UniProt: A3DLR9
Position
485507..486646
Genome map
AA seq 379 aa AA seqDB search
MKLYEFEAKEIAKNNGIPVPRGGIAKTPEEARIVAEKIGGEVVLKAQVLVGRRGLAGGVL
FASNSLEAEKVARELFSKRVRGEKVELILVEEKICIDKEYYLSLTIDRSNREIVYLVSPL
GGVEIEELVKKYPDKLLRIRVDPVIGYKPYMSRLAAKFLGLPKELWPSMHKIMNSMYNIM
KNYDADLVEFNPLVKTCSNEIVAVDAKITIDDNSLYRHIEFAEKYGRELSEMEAIAKKLG
FSYVELDGDIGIMCNGAGLTMATMDMVAYYGGRPANFLDIGGGASRERVREAAKLLLKHD
KVKVLLVNIFGGITRCNEVARGIIEAVEETGVKKPIVIRLLGTNEEIGRRLLEEKGYSVF
SEADDAVKKAVEIAKNLSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttatacgagttcgaggcaaaagagatcgctaaaaacaacggtatacctgttcct
cgaggaggtattgctaaaacacctgaagaggcaagaattgttgctgagaaaattggtggc
gaagtagtgttgaaggctcaagtactggttgggagaagaggattggcaggtggagtctta
ttcgcttctaactctctcgaagctgaaaaagttgctagggaactatttagtaaacgtgtt
cgtggtgaaaaagtagagcttattcttgttgaggagaagatctgtattgataaagaatat
tatttatctctaaccatagaccgctcaaacagggaaatagtataccttgtatcccctctg
ggaggagttgagatagaagaacttgttaagaaatatccggataaattattgaggatcaga
gttgatcccgtaattggatataaaccatacatgtcgcgtttagcagctaaatttctaggt
ttaccaaaagagctatggccaagtatgcataagataatgaattccatgtataatattatg
aaaaactatgatgctgatcttgtagagtttaatccattagttaaaacttgtagtaacgaa
atagtagcagtcgatgctaagataacgattgacgataatagtctttaccgccacatagaa
tttgctgagaaatatgggagagaattatctgagatggaggctatcgctaaaaaacttgga
ttctcctatgtagagcttgacggagatattgggataatgtgtaatggcgccggattaact
atggcgacaatggatatggttgcatattatggtgggagaccagctaacttcctagatata
ggtggtggtgcttcacgtgagagagtcagggaagcagctaagctattattgaaacatgac
aaggttaaagtgcttctagtaaatattttcggcggtataactagatgtaacgaagtagct
agaggaataattgaggctgtagaagaaactggtgttaaaaaaccaattgttattagatta
cttggtaccaacgaggagataggtagaagacttctcgaagagaaagggtatagtgttttt
agcgaagcagatgatgcagttaagaaagctgttgagatagccaagaatttatcaaggtga

DBGET integrated database retrieval system