KEGG   Staphylothermus marinus: Smar_1051Help
Entry
Smar_1051         CDS       T00485                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
smr  Staphylothermus marinus
Pathway
smr00630  Glyoxylate and dicarboxylate metabolism
smr01100  Metabolic pathways
smr01110  Biosynthesis of secondary metabolites
smr01120  Microbial metabolism in diverse environments
smr01130  Biosynthesis of antibiotics
smr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Smar_1051
Enzymes [BR:smr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Smar_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697 LigA
Motif
Other DBs
NCBI-ProteinID: ABN70149
UniProt: A3DND9
Position
complement(1018390..1019721)
Genome map
AA seq 443 aa AA seqDB search
MPHKFEPYHSYIDKNYVPDLENDIIAVFRIKPAKGFTIEDAAGGVAAESSTGTWTTLYPW
YNTERVRKLSGKAYYFKDLGDGSWIVRIAYPVELFEEANMPGLLASIAGNVFGMKRVEGL
RLEDIYLPKKFLQYFKGPSKGVEGVKKIFRVTDRPIVGTVPKPKVGYSPEEVEKLAYELL
VGGMDYIKDDENLTSPSFCRFSERAKHIMRAIDRAEKETGERKVWFANITSDIREMEKRL
KLVADYDNPYVMVDVVVTGWSTLTYIRDLAEEYGLAIHAHRAMHAAFTRNPYHGISMYVL
AKLYRIIGVDQLHIGTAGVGKLEGGKIDVIRYARILREKHFKPDPDDVFHIEQEMYHIKP
AMPVSSGGLHPGNLPGVIDALGTELVLQIGGGVLGHPDGPRAGAMAVRQSLEAILKGIPL
DEYAKTHRELARALEKWGFAKPI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgccacataaattcgagccttatcatagttacatagataaaaactatgttccagattta
gaaaatgacattatagctgttttcagaattaaaccagccaaaggatttacaatagaagat
gcagcaggtggagtagctgctgagagcagtactggtacatggaccacgctgtatccatgg
tataatactgaaagagttcgtaaattatccggcaaagcatattatttcaaagatctaggt
gatggttcatggattgttagaatagcttatccagttgaattatttgaggaagcaaatatg
ccgggcttactagcatcaatagctggaaacgtctttggaatgaagagagttgagggtctt
cgtctcgaagatatttatcttcctaagaagtttctacaatactttaaaggtccaagtaag
ggagttgaaggcgtaaaaaagatctttagagtgactgatcggccaatagtgggcactgtt
ccaaaacctaaagtaggatattcgccggaggaggttgagaaactagcctacgaactacta
gtgggaggaatggattatattaaagacgatgaaaacctgactagtccaagtttttgcaga
ttctccgagagagctaaacatataatgagagcaattgatcgagcagaaaaagaaaccggt
gagagaaaagtttggttcgcaaacatcaccagcgatatacgtgaaatggagaagagatta
aaacttgtagcagactatgataacccctatgtaatggttgatgtagtagtgactggatgg
tctacgctaacatatatcagggatctagctgaagaatatggcttagctattcatgcacat
agagcaatgcatgcagcctttacccgtaacccctaccacggtatatcaatgtatgtatta
gcaaaactctacagaatcattggcgtagaccagctacatattgggactgcaggagtaggt
aaacttgagggaggaaaaatcgatgtaataagatacgcaagaatactgagagaaaaacat
ttcaaaccagaccctgacgatgttttccatatagaacaagaaatgtaccatataaaacca
gcgatgccagtgtcctcaggaggcctacacccaggcaacttgccaggcgtaatagatgct
ttaggaacagaactagtactacaaataggtggaggagtactaggacacccagatggtcca
agagcaggggcgatggcagtaagacaatcattagaagcaatattgaaaggaataccatta
gatgaatacgcgaaaacacatagagaactagcaagggcacttgaaaaatggggatttgct
aaaccaatatag

DBGET integrated database retrieval system