KEGG   Staphylothermus marinus: Smar_1242Help
Entry
Smar_1242         CDS       T00485                                 

Definition
(GenBank) branched-chain acyl-CoA synthetase (ADP-forming) beta subunit / acetyl-CoA synthetase (ADP-forming) beta subunit
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
smr  Staphylothermus marinus
Pathway
smr00010  Glycolysis / Gluconeogenesis
smr00620  Pyruvate metabolism
smr00640  Propanoate metabolism
smr01100  Metabolic pathways
smr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_1242
   00620 Pyruvate metabolism
    Smar_1242
   00640 Propanoate metabolism
    Smar_1242
Enzymes [BR:smr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Smar_1242
Lipid biosynthesis proteins [BR:smr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Smar_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABN70334
UniProt: A3DNX4
Position
1208989..1209684
Genome map
AA seq 231 aa AA seqDB search
MNPREIIQKAYEEKRRKLLEHEAFEIIKAYNIPAPETAIARSLEEAIKIAEKIGYPLVLK
IVSPDISHKSDVGGVILNIKSKEELIKAFNKIYENVSKNAPGARIVGVLIQKMAPKGLEV
IIGGLRDNIFGPVVMFGLGGIFVEVLKDVSFRIAPLTEEDAFEMMSEIKASKLLEGYRGQ
PPVDKKSLAKIILSVSKLLEENPEIESIDLNPVMAYPDNAVVVDARIILKT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctagagaaataatacaaaaagcatatgaggaaaaaagaagaaaactattagaa
cacgaagcattcgaaataataaaagcatataatattcctgcacccgaaacagcaatcgca
agatctctagaagaagcaattaaaatagctgaaaaaataggatatcctcttgtattaaaa
atagtctcaccagatattagccataaaagcgatgttggaggagtaattctcaatattaaa
tccaaagaagaacttatcaaagcattcaataagatatacgaaaacgtatctaaaaatgct
ccaggagctagaatcgttggagtactgatccagaaaatggctccaaaaggattagaagta
attattggtgggttacgagacaacatattcgggcccgtagtaatgtttggtctcggagga
atatttgttgaagtattaaaagatgtatcatttagaatagcaccattaaccgaagaagat
gcttttgagatgatgagtgaaataaaggcatcaaaactattggaaggctatcgtggacag
ccacccgtggataaaaaatcattagctaaaataatattatctgtatcaaaactattagaa
gaaaacccagagattgaatctatagatttaaaccctgtaatggcatatccggataacgca
gtcgtcgttgatgctagaataatacttaaaacttag

DBGET integrated database retrieval system