KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_113Help
Entry
SMDSEM_113        CDS       T00958                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
sms00430  Taurine and hypotaurine metabolism
sms00620  Pyruvate metabolism
sms00640  Propanoate metabolism
sms00680  Methane metabolism
sms01100  Metabolic pathways
sms01120  Microbial metabolism in diverse environments
sms01200  Carbon metabolism
Module
sms_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMDSEM_113 (ackA)
   00640 Propanoate metabolism
    SMDSEM_113 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    SMDSEM_113 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SMDSEM_113 (ackA)
Enzymes [BR:sms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SMDSEM_113 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: ACU52828
UniProt: C7LK66
Position
117947..119155
Genome map
AA seq 402 aa AA seqDB search
MKLLILNLGSSSIKYQLLENKKFLIKGLIERIGMSGSRIKQIVFKKQILKKSILNKKIEN
HFLGIKKMKNLLCDEKVKEIYAIGHRIVHGGYFFSKPTIISDNVKKKIKKLFNIAPIHNY
INYMGIKISEKIFKTSIQVAVFDTEFHSTIPKKSYLYAIPDEFYLKHYIRSYGFHGISHK
FVSKTAIQYLKNKKVKLITMHLGNGSSVTAINSGKSVETSMGFSPNSGLIMGTRSGDIDS
NIIFHALKKGFKIDELIEILNKKSGMLALSGYSDMRDIKKKYEKGDKKARLAYEMYAYRV
KKYIGISISVMNGVDALIFTGGIGENDILMRKLICKDLDFFGIKLDKKKNNFINEKKNVI
EIQKKNKKVKILVIKTNEELQISEEILFLLKKNFKKKELIKC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattaatattaaatttaggaagttcttcaattaaatatcaattattagaaaat
aagaaatttttgataaaaggattaatagaaagaattggaatgtctggaagtagaataaaa
cagattgtttttaaaaaacaaattttaaaaaaaagtattttaaataaaaaaatagagaat
cattttttagggataaaaaaaatgaaaaatttattatgtgatgaaaaggtgaaggaaata
tatgctataggtcatagaatagttcatggaggttatttttttagtaaacctacaataatt
tcagataatgtaaaaaaaaaaataaaaaaactttttaatatagctcctatacataattat
attaattatatgggaataaagatttctgaaaaaatttttaaaacttcaattcaagtagca
gtatttgatactgaattccattctacaattcctaaaaaatcttatttatatgcaattcca
gatgaattttatttaaaacattatattagatcctatggctttcatggaattagtcataaa
tttgtttccaaaacagctatacagtatttaaaaaataagaaagtgaaattaattactatg
catctaggaaatggatcaagtgtaacagctataaattctggaaaatctgtagaaacgtct
atgggattttctccaaatagtggattaataatggggactagatctggggatatagatagt
aatattatttttcatgctttaaaaaaagggtttaaaatagatgaattaattgaaatttta
aataaaaaaagtggaatgttggcattatcaggttatagtgatatgagagatataaaaaaa
aaatatgaaaaaggagataaaaaagcaagattagcatatgaaatgtatgcttatagagta
aaaaaatatattggaatatctatatctgtaatgaatggggtagatgcattaatatttact
ggaggaataggagaaaatgatattttaatgcggaaactgatttgtaaagatttagatttt
tttggaataaaattagataagaaaaaaaataattttattaatgaaaagaaaaatgtcatt
gaaattcaaaaaaaaaataagaaagtgaaaattcttgttattaaaacgaatgaagaatta
caaatatcagaagagattttatttcttttaaaaaaaaattttaaaaaaaaagaattaatt
aaatgttaa

DBGET integrated database retrieval system