KEGG   Stenotrophomonas maltophilia R551-3: Smal_0942Help
Entry
Smal_0942         CDS       T00733                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00240  Pyrimidine metabolism
smt00250  Alanine, aspartate and glutamate metabolism
smt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Smal_0942
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Smal_0942
Enzymes [BR:smt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Smal_0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACF50647
UniProt: B4SMH0
Position
1087993..1088943
Genome map
AA seq 316 aa AA seqDB search
MTAQQLDASGRLRHLLTLEGLPRETLLQLLDRAGQIRDAAVGRVGNKRQVLAGSAVCTLF
FEPSTRTRSSFQLAAQRLGADVLNFDASTSSTRKGETACDTLRNLEAMGVRGFVVRHPDD
GAVAALAEAAGEGTALINAGDGRSAHPTQGLLDMLTLRQAKGPDFSKMKVVIVGDVKHSR
VARTDLHALRTLGVGEIRVCGPQSLLPDDETLKGCVVGDDFDAMLEGVDALMMLRLQRER
MEEGLVPSLEQYHAQYGLTNERLARAGKDAAVLHPGPINRGVEVTDEVADGPQSWVLRQV
ANGVAVRMAVLETLLG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagcaactcgatgcctccggccgcctgcgccacctgctgaccctcgaaggc
cttccgcgcgagaccctgctgcagctgcttgaccgcgccggccagatccgcgatgccgcg
gtcggtcgtgtcggcaacaagcgccaggtgctggccggctcagcggtgtgcacgctgttc
ttcgaaccgtccacgcgcacccgcagctcgttccagctggccgcgcagcgcctgggcgcc
gacgtgctgaacttcgatgcctcgacctcgtccacgcgcaagggcgaaaccgcctgcgac
acgctgcgcaacctggaagcgatgggcgtgcgcggcttcgtggtgcgccaccccgatgat
ggcgccgtggccgcactggccgaagcggcgggcgagggcaccgcgctgatcaatgccggt
gacggtcgcagcgcgcacccgacccagggcctgctcgacatgctgaccctgcgccaggcc
aagggccctgatttctcgaagatgaaggtggtgatcgtcggcgacgtgaagcattcgcgc
gtggcccgcaccgacctgcatgcgctgcgtacgctgggcgtgggcgagatccgcgtgtgc
ggcccgcagtcgctgctgcccgacgacgagaccctgaagggctgcgtggtcggtgatgat
ttcgacgcgatgctggaaggcgtcgacgcgctgatgatgctgcgcctgcagcgcgagcgc
atggaggaaggcctggtgccgtcgctggagcagtaccacgcgcagtacggcctgaccaac
gaacgcctggcccgcgccggcaaggatgcagccgtgctgcatccaggcccgatcaaccgc
ggcgtggaagtgaccgacgaagtggccgacggcccgcagtcgtgggtgctgcgccaggtc
gccaacggcgtcgccgtgcgcatggccgtgctggaaacgctgctgggctga

DBGET integrated database retrieval system