KEGG   Stenotrophomonas maltophilia R551-3: Smal_1766Help
Entry
Smal_1766         CDS       T00733                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00010  Glycolysis / Gluconeogenesis
smt00052  Galactose metabolism
smt00500  Starch and sucrose metabolism
smt00520  Amino sugar and nucleotide sugar metabolism
smt00521  Streptomycin biosynthesis
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01120  Microbial metabolism in diverse environments
smt01130  Biosynthesis of antibiotics
smt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_1766
   00052 Galactose metabolism
    Smal_1766
   00500 Starch and sucrose metabolism
    Smal_1766
   00520 Amino sugar and nucleotide sugar metabolism
    Smal_1766
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smal_1766
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Smal_1766
Enzymes [BR:smt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smal_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACF51470
UniProt: B4STP6
Position
1976688..1977710
Genome map
AA seq 340 aa AA seqDB search
MTIAAASPVSTDSARGGLPRSLVVADVGGTFARLALAETQPGQAPLLGSHRTYACAEHPS
LAAILADFTAGLGQPVQTAVVAIAGLLDGDVLINANLPWTVSLSTTREQSGLRELQLIND
FEAVALAIPYLQPETLVPLNGDADPAQAFPALVLGAGTGLGAALRFADGERPVLASEIGH
AALGAGNALELQVLGKLLQRWAHVDNERVLSGSGLMNLYPCLCELRGATPVWTSTEALIG
AARSGEDALAVETLQVFCAWLGSLAGDAAIAVGARSVYLAGGISAHVQDFLADGRFRERF
LNKGVLTEVLRQVPVWRVEHGQLGVLGAAVWHAARQPTHD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgcagcagcgtccccggtttccaccgactccgcccgcggcggtcttccgcgc
agtctcgttgtcgccgatgtcggcggcaccttcgcccgtctggccttggctgagacccaa
cccggccaggcgccgctgctgggcagccatcgcacctatgcctgcgccgagcaccccagc
ctggccgcgatcctggccgatttcaccgctggtctcggccagccggtgcagaccgcagtg
gtggccatcgccggtctgctcgatggcgatgtgctgatcaatgccaacctgccgtggacg
gtctcgctgtcgaccacgcgcgaacagtctgggctgcgcgaactgcagctgatcaatgat
ttcgaggcggtggcgctggccatcccgtacctgcagccggaaaccctggtgccgctgaac
ggcgatgctgatccggcgcaggcgttcccggcactggtgctgggcgccggtaccggcctg
ggcgccgcactgcgcttcgccgatggcgagcggccggtgctggccagcgagatcggccat
gccgcgctcggtgcaggcaacgcgctggaactgcaggtgttgggcaagctgctgcagcgc
tgggcgcacgtggacaacgagcgcgtgctgtccggtagtggcctgatgaacctgtacccg
tgcctgtgcgagctgcgcggtgccaccccggtgtggaccagcaccgaagcactgatcggt
gccgcccgcagcggtgaggacgctcttgctgtggaaacgttgcaggtgttctgtgcctgg
ctgggcagcctggccggcgacgcggcgatcgccgtcggcgcgcgctcggtgtatctggcc
gggggcatttccgcgcatgtgcaggatttcctggccgatggccgcttccgtgagcgattc
ctcaacaagggtgtgctgaccgaggtgctgcgccaggtaccggtgtggcgggtggagcac
ggccagctgggcgtgctcggtgcagcggtctggcacgccgcacggcagcccacgcacgac
tga

DBGET integrated database retrieval system