KEGG   Stenotrophomonas maltophilia R551-3: Smal_2447
Entry
Smal_2447         CDS       T00733                                 
Name
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K03204  type IV secretion system protein VirB9
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Smal_2447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smt02044]
    Smal_2447
Secretion system [BR:smt02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Smal_2447
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ACF52150
UniProt: B4SNC5
Position
complement(2751712..2752491)
AA seq 259 aa
MSSRNIRGSALVLLSMLSLLFSAAAMAQAVDHYEYEKDRIYPVRTGLGLTTQIELSPNEK
ILDYSTGFSSGWELTRRENVFYIKPKNVDVDTNMMVRTETHSYIFELKVVATDWRQLEQA
RRAGVQYKIAFVYPNDTVFGVAQEAVEEEAKPLLSSELAKDRQYNFNYSYSTSKAKKMGW
LIPVNAYDDGRFTYLKLPNSPEYKTGIFPAVFGRETEYGEDFVVNTTVEGNTLIVHGTHP
YLVIRHGDFVVGLRRNVKK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagtagtcgaaatatcaggggaagcgcactggtgctgctgtcgatgttgtcgctgttg
ttttcagcagcggcgatggcgcaggcggtggaccactacgagtacgagaaggaccgcatc
tatccggttcgcaccggcctgggcctgaccacccagatcgaactgagcccgaacgagaag
atcctcgactacagcaccggcttcagcagcggctgggaactgacccgtcgcgaaaacgtg
ttctacatcaagccgaagaacgtcgacgtcgacaccaacatgatggtgcgcaccgagact
cattcctacatcttcgagctgaaggtggtggccactgattggcgccagctggaacaggcc
cgtcgtgcaggcgtgcagtacaagattgccttcgtctatcccaacgacaccgtgttcggc
gtcgcccaggaggcggtcgaggaagaggccaagccgctgttgagctctgaactggccaag
gaccgccagtacaacttcaactactcctattcgaccagcaaggcgaaaaagatggggtgg
ttgatcccggtcaacgcctacgacgatggccgcttcacctatctgaagctgccgaactcg
ccggaatacaagaccggcatattcccggccgtgttcggccgtgaaacggaatacggtgaa
gacttcgtggtcaacaccacggttgaaggcaatacgctgatcgtgcacgggacgcacccg
tacctggtcatccgccatggcgacttcgtcgtcggcctgcgaaggaacgtgaagaaatga

DBGET integrated database retrieval system