KEGG   Stenotrophomonas maltophilia R551-3: Smal_2451Help
Entry
Smal_2451         CDS       T00733                                 

Definition
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Smal_2451
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smt02044]
    Smal_2451
Enzymes [BR:smt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smal_2451
Secretion system [BR:smt02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Smal_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACF52154
UniProt: B4SNC9
Position
complement(2754506..2756185)
Genome map
AA seq 559 aa AA seqDB search
MLPSKKYLLIAIITLATLLLGFVFSGYLTLLLLGLDTKLFTWNTYYQYFNALGQPQVAPF
VGKIKWAGYLGFGLPLLVLLVTGLVLLLKKDKRSLHGDARFATSADLSKHGMFKKTGQSI
VVGSHGGKLVRLDGQQFVILAAPTRSGKGVGVVIPNLLEYGESLVVLDIKQENFDLTSGW
RASQGQEIYLFNPFAEDRRTHRWNPLSYVSDDPAFRVSDLMSIAAMLYPDGAEDQKFWVS
QARNAFMAFTLYLFENWDDERSSGFPGGSGTPTLGAVYRLSSGDGSDLKKYLKALSERSF
LSSNARSAFANMLSQADETFASILGTFKEPLNAWINPVLDKATSSNDFLLTDVRKKKMTI
YIGIQPNKLAESRLIINLFFSQLINLNTKELPKSNPDLKYQCLLLMDEFTSIGKVEIIAS
AVSYMAGYNIRLLPIIQSMSQLDATYGREVSRTIITNHALQILYAPREQQDANDYSDMLG
YTTIRKKNVTHAREKTHSFTEERRALMLPQELKAMGPDKEVFLYEGIPHPVKCDKIRYYK
DRYFTSRLLPKVDVPMLNV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcccagtaagaagtatctgctcatcgccatcatcacgctggcgaccctgctgctt
ggtttcgtgttttccggttacctgaccctgttgttgctggggctggacaccaagctgttc
acctggaacacctactatcagtacttcaacgcgctcggccagccacaggtcgcgcccttc
gtgggcaagatcaagtgggccggctatctcggtttcggcctgccgctgctggtgctgctg
gtgaccggcctggtgctgctgctgaagaaggacaagcgctcgctgcacggcgacgcacgc
tttgccaccagcgccgacctgtccaagcacggcatgttcaagaagaccggccagagcatc
gtggtcggcagtcatggtggcaagctggtgcggctggacggccagcagttcgtgatcctg
gccgcgccgacccgctcgggcaagggcgtgggcgtcgtcatcccgaacctgctggagtac
ggcgaatcgctggtggtgctggacatcaagcaggagaacttcgacctgaccagcggctgg
cgtgccagccagggccaggagatctacctgttcaatcccttcgccgaagaccgccgcacg
catcgctggaatccgctcagctacgtctccgacgacccggcgttccgcgtttcggacctg
atgagcatcgccgcgatgctgtatccggatggtgccgaggaccagaaattctgggtcagc
caggcgcgcaatgcgttcatggccttcaccctgtatctgttcgagaactgggatgacgag
cgcagcagtggcttcccgggcggctcgggcacgcccaccctgggcgctgtctaccggttg
tcatcgggtgacggcagcgatctgaagaagtacctcaaagccttgtcggagcggtcgttc
ctcagttccaacgcgcgctcggcgtttgccaacatgctgtcccaggccgatgagaccttc
gcctcgatcctgggtaccttcaaggaaccgctcaacgcctggatcaacccggtgctggac
aaggccaccagcagcaacgacttcctgctgaccgatgtccgcaagaagaagatgaccatc
tacatcggcatccagcccaacaagctggccgagagccgcctgatcatcaacctgttcttc
agccagctgatcaacctcaacaccaaggaactgcccaagtccaacccggacctgaagtac
cagtgcctgctgctgatggacgaattcacctcgatcggcaaggtcgagatcatcgcctcg
gcggtgtcctacatggccggctacaacatccgcctgctgccgatcatccagagcatgtcc
cagctcgatgccacctacgggcgggaggtgtcgcgcacgatcatcaccaaccacgcgctg
cagatcctgtacgcgccgcgtgagcagcaggacgccaacgactactcggacatgctgggt
tacaccaccatccgcaagaagaacgtcacccatgcccgcgagaagacccacagcttcacc
gaggagcggcgcgcactgatgctgccgcaggagctgaaggcgatggggccggacaaggaa
gtgttcctctacgagggcataccgcatcctgtgaagtgcgacaagatccgctactacaag
gatcgctacttcacctcgcgattgctgccgaaagtggatgttccgatgcttaacgtctaa

DBGET integrated database retrieval system