KEGG   Stenotrophomonas maltophilia R551-3: Smal_2618Help
Entry
Smal_2618         CDS       T00733                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00480  Glutathione metabolism
smt00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Smal_2618
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smal_2618
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Smal_2618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx DUF4174 AhpC-TSA Robl_LC7
Motif
Other DBs
NCBI-ProteinID: ACF52318
UniProt: B4SPC3
Position
complement(2925012..2925599)
Genome map
AA seq 195 aa AA seqDB search
MPLPTVSSRRLRGLSLLVLMVAGAAGSGSALAADLLDLDYRPLAGKQQVNLQQRYQGQVL
LVVNTASKCGYTPQYEGLEALQKRYAGRGFAVLGFPSNDFKGQEPGDEKQIQDFCTLTYG
VKFPMFEKVHVVGAQATPLYQRLSAATGVAPAWNFHKYLVGRDGKVIAQFASKVTPDDAQ
LTAAIDKALAAAATH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgccgactgtttcctcgcgccgcctgcgcggcctgtccctgctggtcctgatg
gtggccggcgctgctggttccggcagtgcccttgctgccgatctgctcgacctggattac
cggccgctggccggcaagcagcaggtcaacctgcagcagcgctaccaggggcaggtgctg
ctggtggtcaacaccgccagcaagtgcggctataccccgcagtacgaagggctggaagcg
ctgcagaagcgctatgcggggcgtggcttcgccgtgcttggtttcccgtccaatgatttc
aagggccaggagccgggtgacgagaagcagatccaggatttctgcacgctgacctacggc
gtcaagttcccgatgttcgagaaggtgcatgtggtgggggcgcaggcaacgccgctttac
cagcggctgagcgcagccaccggcgtagccccggcctggaacttccacaagtacctggtc
ggccgcgatggcaaggtcatcgcccagttcgccagcaaggtgacgccggatgatgcacag
ctcaccgccgccatcgacaaggcgctggccgctgccgccacgcattga

DBGET integrated database retrieval system