KEGG   Stenotrophomonas maltophilia R551-3: Smal_2955Help
Entry
Smal_2955         CDS       T00733                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00071  Fatty acid degradation
smt00072  Synthesis and degradation of ketone bodies
smt00280  Valine, leucine and isoleucine degradation
smt00310  Lysine degradation
smt00362  Benzoate degradation
smt00380  Tryptophan metabolism
smt00620  Pyruvate metabolism
smt00630  Glyoxylate and dicarboxylate metabolism
smt00640  Propanoate metabolism
smt00650  Butanoate metabolism
smt00900  Terpenoid backbone biosynthesis
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01120  Microbial metabolism in diverse environments
smt01130  Biosynthesis of antibiotics
smt01200  Carbon metabolism
smt01212  Fatty acid metabolism
smt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smal_2955
   00630 Glyoxylate and dicarboxylate metabolism
    Smal_2955
   00640 Propanoate metabolism
    Smal_2955
   00650 Butanoate metabolism
    Smal_2955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Smal_2955
   00072 Synthesis and degradation of ketone bodies
    Smal_2955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smal_2955
   00310 Lysine degradation
    Smal_2955
   00380 Tryptophan metabolism
    Smal_2955
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Smal_2955
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smal_2955
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smal_2955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smt04147]
    Smal_2955
Enzymes [BR:smt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Smal_2955
Exosome [BR:smt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smal_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C B12-binding DUF3323 ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACF52654
UniProt: B4SRJ0
Position
3292563..3293738
Genome map
AA seq 391 aa AA seqDB search
MSNIVIAAAKRTAIGSFLGQFTGVPTPTLGAAAIAAALEQSGVPASDVSEVLMGCVLPAN
LGQAPARQAAIAAGIPLSVGATTLNKVCGSGMKTIMLGHDLIKAGSARIVVAGGMESMSN
APHMLPNSRTGNRFGNFQAVDHMAHDGLVNAYDGKAMGEFAECAVDKYQFSREEQDAYAI
ESVKRAQAAQANGAFADEIVAVKVATRKGEVEVATDEQPGRSDIAKIPTLRPAFKKDGSV
TAASSSSISDGAAAVVLLTEEDAAARGITPLARIVGHATHSQEPEWFTTAPIGALHTLLD
KTGWSLDQVDLFEINEAFAVVAMAPMRELGIPHDKLNVNGGACALGHPIGASGARLVVTL
VNALRTRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacatcgtcatcgccgccgccaagcgcaccgccatcggctccttcctcggccag
ttcaccggcgtgccgacacccaccctcggcgcggccgccatcgccgccgccctggaacaa
tcgggtgtcccggccagcgacgtttccgaagtcctgatgggctgcgtgctgccggccaac
ctcggccaggcgcccgcccgccaggccgcgatcgctgccggcatcccgctgtcggtcggt
gctaccaccctcaacaaggtgtgcggctcgggcatgaagaccatcatgctcggccatgac
ctgatcaaggccggctcggcccgcatcgtggtcgccggcggcatggagtcgatgtccaat
gcgccgcacatgctgccgaactcgcgcacgggcaaccgcttcggcaacttccaggcagtc
gaccacatggcccacgatgggctggtcaacgcctacgacggcaaggcgatgggtgagttc
gccgagtgcgccgtggacaagtatcagttcagccgcgaagagcaggacgcctacgccatc
gaatcggtcaagcgcgcgcaggccgcacaggccaacggcgcgttcgccgatgaaatcgtc
gcggtgaaggtcgccacccgcaagggcgaggtcgaggtcgccaccgacgagcagccgggc
cgctcggacatcgccaagatcccgaccctgcgcccggccttcaagaaggacggcagcgtg
accgccgccagttcctccagcatctccgacggcgctgcagcagtggtcctgctgaccgag
gaagatgcagccgcacgcggcatcaccccgctggcgcgcatcgtcggccacgcgacccat
tcgcaggaaccggagtggttcaccaccgccccgatcggcgcgctgcacacgctgctggac
aagaccggctggtcgctggaccaggtcgacctgttcgaaatcaacgaggcttttgccgtg
gtcgcaatggcgccgatgcgcgaactgggcatcccgcacgacaagctcaacgtgaatggc
ggtgcctgcgctttgggccatccgatcggtgcctccggcgcacgtctggtggtgaccctg
gtcaacgccctgcgcacgcgcggtggcaagcgcggcattgccaccctgtgcatcggcggc
ggcgaagcaaccgcaatcgccatcgaattgatttaa

DBGET integrated database retrieval system