KEGG   Stenotrophomonas maltophilia R551-3: Smal_3718Help
Entry
Smal_3718         CDS       T00733                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01130  Biosynthesis of antibiotics
smt01230  Biosynthesis of amino acids
Module
smt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smal_3718
Enzymes [BR:smt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Smal_3718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACF53417
UniProt: B4SLE8
Position
complement(4186253..4187047)
Genome map
AA seq 264 aa AA seqDB search
MSDILQTILARKAEEVAQRRAQRPLEDLQVAVASAPPVRGFVRALQAAVANGDPAVIAEV
KKASPSKGVIRPDFRPADIAVSYEFGGASCLSVLTDVDFFQGADAYLQQARDACTLPVLR
KDFVIDAYQVYEARVLGADCILLIVAALDDTQLATLSELAMSLGMDVLVEVHDIDELERA
LQVPAPMIGINNRNLRTFEVSLQTTLDMQKAVPRDRLLVTESGILGPQDVALMRDAGIHS
FLVGEAFMRVEEPGEGLRQLFFAA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctgcagacgatcctggcccgcaaggccgaagaagtggcccagcgccgt
gcccagcgtcccctcgaggacctgcaggtcgccgtggccagcgccccgccggtacgtggc
ttcgtgcgcgcgctgcaggcggcggtggccaacggcgacccggcggtgatcgccgaggtg
aagaaggccagcccgtccaagggcgtgatccgcccggatttccgcccggccgacatcgcg
gtcagctatgagttcggcggcgccagctgcctgtcggtgctgaccgatgtggacttcttc
cagggtgctgatgcctacctgcagcaggcccgtgacgcctgcacgctgccggtgctgcgc
aaggacttcgtgatcgacgcctaccaggtgtatgaggcgcgtgtgctgggtgccgactgc
atcctgctgatcgtcgccgcgctggacgacacgcagttggccacgctgtccgaactggcg
atgtcgctgggcatggacgtactggtggaagtgcacgacatcgacgagctggagcgtgcg
ctgcaggtgccggcaccgatgatcggcatcaacaaccgcaacctgcgcaccttcgaggtg
tcgctgcagaccacgctggacatgcagaaggcggtgccgcgcgatcgcctgctggtcacc
gagagcggcatcctcggcccgcaggacgtggcgctgatgcgcgacgccggcatccactcg
ttcctggtgggcgaggccttcatgcgcgtggaagagccgggcgagggcctgcgtcagcta
ttcttcgcggcatga

DBGET integrated database retrieval system