KEGG   Streptococcus mutans UA159 (serotype c): SMU_1086Help
Entry
SMU_1086          CDS       T00100                                 

Gene name
kitH
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00240  Pyrimidine metabolism
smu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SMU_1086 (kitH)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SMU_1086 (kitH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 KdpD
Motif
Other DBs
NCBI-GeneID: 1029394
NCBI-ProteinID: NP_721478
UniProt: Q8DU63
Position
complement(1030550..1031134)
Genome map
AA seq 194 aa AA seqDB search
MTVLAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSSLDTRDGFGVVASRIGMRR
EAVTITDDMDIFAYIENMFKKPYCILIDESQFLSQKNVYDLARIVDELDVPVMAFGLKND
FQNHLFEGSRELLLLADKIEEIKTICQFCSKKATMVLRTENGRPVYKGNQIQIGGNETYI
PVCRRHYFHPPIKA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcttggcgcagttatattataaatatgggaccatgaattcaggtaagacaatc
gaaattttaaaggttgctcataattatgaagaacaaggaaagcctgttgtcattatgacg
agcagcttggacacgcgagatggatttggtgtggtggctagtagaattggcatgcgacgt
gaagcagttactattacagatgacatggatatttttgcttacatcgaaaacatgtttaag
aaaccttattgtattttaattgatgaaagtcagtttttaagccaaaaaaatgtttatgat
ctagcaaggattgttgatgaattggatgttcctgttatggcctttgggctcaaaaatgat
tttcagaaccatctctttgaagggtcacgtgaactcttgctgttagctgataagattgag
gaaattaaaactatctgtcaattttgctccaaaaaggcaactatggttttaagaacagaa
aatggcaggcctgtctataagggcaatcaaattcaaatcggcggtaatgaaacttatatt
cctgtctgtcgaagacattacttccatcctccaatcaaagcctga

DBGET integrated database retrieval system