KEGG   Streptococcus mutans UA159 (serotype c): SMU_1191Help
Entry
SMU_1191          CDS       T00100                                 

Gene name
pfk
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00030  Pentose phosphate pathway
smu00051  Fructose and mannose metabolism
smu00052  Galactose metabolism
smu00680  Methane metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01130  Biosynthesis of antibiotics
smu01200  Carbon metabolism
smu01230  Biosynthesis of amino acids
smu03018  RNA degradation
Module
smu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_1191 (pfk)
   00030 Pentose phosphate pathway
    SMU_1191 (pfk)
   00051 Fructose and mannose metabolism
    SMU_1191 (pfk)
   00052 Galactose metabolism
    SMU_1191 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SMU_1191 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SMU_1191 (pfk)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SMU_1191 (pfk)
Protein phosphatases and associated proteins [BR:smu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SMU_1191 (pfk)
Messenger RNA biogenesis [BR:smu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SMU_1191 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-GeneID: 1028488
NCBI-ProteinID: NP_721574
UniProt: Q8DTX6
Position
complement(1132337..1133350)
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAISEGMEVCGINRGYAGMVEGDIFPLDAKGVSNI
LSRGGTFLQSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVNTATDALDKIRDTSFSHGRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEPYDIKEVVANVKNGYLSKSKNHHLIVLAEGVMHGEEFAAQMKEAGD
NSDLRVTNLGHILRGGAPTPRDRVIASWMGAHAVELLREGKGGLAIGIQNEELVEHPILG
SAEDGALFSLTEQGEIVVNNPHKARLDFAALNRDLSN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggcggagacgctcctggtatgaatgctgccgtt
cgtgcagtcgttcgtaaagcaatttctgaaggaatggaagtttgcggaatcaatcgtggt
tatgctggtatggttgaaggagatatcttcccgcttgacgctaaaggtgtatcaaacatc
ctttctcgtggagggacatttctccagtccgcacgttaccctgaatttgcaaagcttgag
gggcaattaaagggtatcgagcaactcaaaaagcatggcattgaaggagtcgttgttata
ggtggcgatggttcttatcatggtgcgatgcgcttgactgagcatggttttcctgctgtc
ggtcttccgggtacaattgataacgatatcgtaggaactgattatacaattggttttgat
actgcagtaaacactgctacggatgcacttgataaaattcgtgatacctcatttagtcac
ggcagaacttttgttgttgaggttatgggacgtaatgcaggagatattgctctttggtct
ggtattgctgccggtgctgaccaaattattattcctgaagagccctatgatattaaagag
gttgtcgccaatgtgaaaaatggctatcttagtaagtctaaaaaccaccatctcattgtt
cttgccgaaggcgttatgcatggtgaagagtttgctgctcagatgaaggaagcaggagat
aatagtgatcttcgtgttaccaaccttgggcatatcctgcgcggtggtgcaccaactcct
cgtgatcgtgtgattgcttcatggatgggagcccatgccgttgaattgctcagggaagga
aaaggcggtcttgccattggtattcaaaatgaggagttggttgagcatccaattcttgga
tctgcggaagacggtgcactctttagtttaacagaacaaggcgagatcgttgtaaataat
ccgcataaagcacgtcttgattttgctgctttgaatcgtgatttgtccaactaa

DBGET integrated database retrieval system