KEGG   Streptococcus mutans UA159 (serotype c): SMU_1867cHelp
Entry
SMU_1867c         CDS       T00100                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00350  Tyrosine metabolism
smu00625  Chloroalkane and chloroalkene degradation
smu00626  Naphthalene degradation
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01130  Biosynthesis of antibiotics
smu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_1867c
  Lipid metabolism
   00071 Fatty acid degradation
    SMU_1867c
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMU_1867c
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMU_1867c
   00626 Naphthalene degradation
    SMU_1867c
Enzymes [BR:smu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMU_1867c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 1029073
NCBI-ProteinID: NP_722179
UniProt: Q8DSD3
Position
complement(1759940..1760989)
Genome map
AA seq 349 aa AA seqDB search
MKTAVFVKAGQMAIETIEKPSVIEVDDAIIRVVRACVCGSDLWSYRGDDDKATHSANSGH
EIIGIVDEVGSAINTVKKGDFVIAPFTHGCGHCAACRAGFEGGCQGHDRSTNFSSGYQAE
YVRYAHADWSLVKIPGQPSDYSEGMIASLLALADVMPTGYHAARVANVQKGDTVAVVGDG
AVGLCAVIAAKMRGAKRIIIMSRHKDRQELALEFGATDIVEERGEEGVAKVLELTNGDGV
DAALECVGTQLSTETALAIARPGASIGRVGVPHTKDINLSDYFFQNAIIAGGPASVTTYD
KSVLLKAVLDGEINPGKVFTQSYSLDDIDQAYKDMQERKTIKSMVVVSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcagtgtttgtaaaagctggtcaaatggccattgaaactattgagaagcca
agtgttattgaagttgatgatgcgatcatccgtgtcgtccgtgcttgtgtctgtggttct
gatctgtggtcttatcgtggagatgatgacaaagctacgcattcagccaactcaggtcac
gaaattatcggaatcgttgatgaagttggctctgctattaatacagtgaaaaaaggagac
tttgttattgcaccattcacgcatggttgcggtcattgtgcagcttgtcgtgctggtttt
gaaggaggttgtcaaggacacgatcggtcaacaaacttttcaagtggttatcaagccgaa
tatgttcgttatgctcatgctgattggtctttagtaaaaattccgggtcaacctagcgat
tattcagaaggtatgattgcttcgcttttagctttggcggatgttatgccaacaggctat
catgcagcgcgcgtggccaatgttcaaaagggggatacggttgcagttgttggcgatgga
gcggttggactctgtgctgttatcgcagctaaaatgcgtggagctaaacgtatcattatc
atgagtcgccacaaggatcgtcaggaattggcgttggaatttggcgctactgatattgta
gaagagcgcggcgaagaaggtgtagctaaagttcttgaactgacaaatggcgatggtgtt
gatgccgctcttgaatgtgtcggaactcagctgtctactgaaacagcgttagctattgcc
cgtccaggtgcatctatcggtcgcgtgggtgttccacataccaaagatattaatctttcc
gattacttcttccaaaacgctattattgcaggtggaccagcatcagtaacgacttatgac
aaatcggttcttctcaaggctgttcttgatggtgagattaatccaggaaaggtcttcact
caatcttacagcttagatgatattgatcaagcctataaggatatgcaggagcgcaagacc
attaagtctatggttgtcgttagcaaatga

DBGET integrated database retrieval system