KEGG   Streptococcus mutans UA159 (serotype c): SMU_1996Help
Entry
SMU_1996          CDS       T00100                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00900  Terpenoid backbone biosynthesis
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMU_1996 (ipk)
Enzymes [BR:smu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SMU_1996 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 1029155
NCBI-ProteinID: NP_722294
UniProt: Q8DS40
Position
complement(1871026..1871874)
Genome map
AA seq 282 aa AA seqDB search
MEIIEKAPAKINLGLDIAGKYQDGFHELSMIMASVDLNDYLTITEIAEDKIVVESNNCKL
PLNRKNDVYKAAHLLKRRYHISTGLKISLQKKIPICAGLGGGSSDAAATLRALNCLWKLN
LSPKELIDVGFEIGSDVPYCIEAGCALISGKGEIVEPLATTLSTWVVLVKPDFGISTKTI
FKEIDMATISRVDIPALKEALLANYYEDALQFMGNSLEDITIAKKPFIQKIKGRMIKCGA
DIALMTGSGPTVFALCRTEKRADRVVNSMKGFCKEVYKVRML
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaaattattgaaaaagctccggctaaaatcaatcttggtcttgatattgctggaaaa
tatcaagatggttttcacgaattgtcaatgattatggccagtgttgatttaaatgattat
ttgactattacagaaattgctgaggataagatagttgtagaatcaaataattgcaaatta
cctttaaaccgaaaaaatgatgtttataaagctgctcatcttctaaagaggagataccat
atctcaacggggctcaaaatatctcttcaaaaaaagatacctatatgtgctggtttaggc
ggcgggtccagtgatgctgctgcaactttacgtgctctcaattgtttgtggaaactcaat
ttatcaccaaaagaactaattgatgttggttttgaaattggaagtgatgttccttattgc
attgaagcaggctgtgctttaatttcaggtaaaggtgaaattgtagaacctttagcgact
actttgtcaacttgggtggttttggtcaaacctgattttggaatttcaacgaaaacaatc
tttaaagaaattgatatggcaacaatttctcgagttgatattcctgctctaaaagaggca
cttttagcaaattattatgaggatgccttacaatttatggggaattctcttgaagatatt
actattgctaaaaaaccttttattcaaaaaataaaaggccgtatgataaaatgtggtgcg
gatattgctttgatgacgggaagtggaccaaccgtttttgctctctgtcgaacggaaaaa
cgagcggatcgtgttgttaatagcatgaaaggtttttgtaaggaagtttataaagttaga
atgttatag

DBGET integrated database retrieval system