KEGG   Streptococcus mutans UA159 (serotype c): SMU_2022Help
Entry
SMU_2022          CDS       T00100                                 

Gene name
rl22
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:smu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SMU_2022 (rl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:smu03011]
    SMU_2022 (rl22)
Ribosome [BR:smu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SMU_2022 (rl22)
  Bacteria
    SMU_2022 (rl22)
  Archaea
    SMU_2022 (rl22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 1029212
NCBI-ProteinID: NP_722319
UniProt: Q8DS19
Position
complement(1891566..1891910)
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARIVEKTLNSAVA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVEEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtccgtgtttcacctcgtaaa
acacgtcttgtgcttgatcttattcgtggtaagaacgttgctgacgcaatcgcaatcttg
aaattcactccaaacaaagctgctcgtattgttgagaaaactcttaactctgctgtcgca
aatgcagaaaataactttggtttggaaaaagctaatttggtcgtatctgaaactttcgca
aacgaaggaccaacgatgaaacgtttccgtccgcgtgcgaagggttcggcttcaccaatc
aataaacgtacaactcacgttactgtagttgtagaagaaaaataa

DBGET integrated database retrieval system