KEGG   Streptococcus mutans UA159 (serotype c): SMU_538Help
Entry
SMU_538           CDS       T00100                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00260  Glycine, serine and threonine metabolism
smu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01130  Biosynthesis of antibiotics
smu01230  Biosynthesis of amino acids
Module
smu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMU_538 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMU_538 (trpA)
Enzymes [BR:smu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMU_538 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-GeneID: 1029455
NCBI-ProteinID: NP_720975
UniProt: Q8DVF2
Position
503943..504725
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKAEGKGLFIPYIMAGDHDKGLDGLFDTISFLEAQGVSAIEIGIPWSDP
VADGPVIELAGQRSLVKGTSLASIIARLQEKKTQVPLVIMTYFNPVFQYGVETFVADLQN
TSVKGLIIPDLPHEQESFIKPYLENLDLALVPLVSLTTGLERQKELIEDARGFVYAVAIN
GVTGKTGNYRDDLDKHLKHLTEIAQIPVLTGFGVSTLADIKRFNQVSDGVIVGSKIVKGL
HEGMQEEIKDFIYAGSHYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactgacaaagcatttacaagctatcaaggcagaaggcaaaggtcttttt
attccttatattatggctggggatcatgataaaggtttagacggtctctttgataccatt
tcttttttggaagctcaaggtgtatcagccattgaaattggcattccatggtcggatcct
gtggcagatggtcctgttattgaattggctggccaacgtagtttggtaaaggggacatcg
ctggcaagcattattgctaggttacaggaaaagaaaacgcaagtgccacttgttatcatg
acttattttaatcctgtttttcagtatggtgttgaaacatttgttgcagatttgcaaaat
acatctgtcaaaggattgattattcccgatttacctcatgaacaagaaagttttatcaaa
ccttatctggaaaatttagatttagctttagttcctttagtcagcttaacaacaggtcta
gaacgtcaaaaggaactcattgaagatgctcgaggatttgtctacgctgttgctattaat
ggtgttaccggaaaaacagggaattatcgtgatgatttggataaacatttaaaacatttg
acagaaattgctcaaatccctgttttaactggatttggtgtatcaactttagcagatatt
aagcgctttaaccaagtatcagatggtgtcattgttggttcaaaaattgtcaagggatta
catgaaggaatgcaagaagaaataaaagatttcatttatgcaggaagccattatcaaaaa
taa

DBGET integrated database retrieval system