KEGG   Streptococcus mutans UA159 (serotype c): SMU_99Help
Entry
SMU_99            CDS       T00100                                 

Gene name
fbaA
Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
smu  Streptococcus mutans UA159 (serotype c)
Pathway
smu00010  Glycolysis / Gluconeogenesis
smu00030  Pentose phosphate pathway
smu00051  Fructose and mannose metabolism
smu00680  Methane metabolism
smu01100  Metabolic pathways
smu01110  Biosynthesis of secondary metabolites
smu01120  Microbial metabolism in diverse environments
smu01130  Biosynthesis of antibiotics
smu01200  Carbon metabolism
smu01230  Biosynthesis of amino acids
Module
smu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMU_99 (fbaA)
   00030 Pentose phosphate pathway
    SMU_99 (fbaA)
   00051 Fructose and mannose metabolism
    SMU_99 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    SMU_99 (fbaA)
Enzymes [BR:smu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SMU_99 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase ThiG CutC Radical_SAM
Motif
Other DBs
NCBI-GeneID: 1029679
NCBI-ProteinID: NP_720575
UniProt: Q8DWG0
Position
100574..101455
Genome map
AA seq 293 aa AA seqDB search
MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGY
KLCKVLIETLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLEKAK
EVVAKAHAKGISVEAEVGTIGGEEDGIIGRGELAPIDDAKAMVETGIDFLAAGIGNIHGP
YPANWEGLDLDHLKKLTEAVPGFPIVLHGGSGIPDDQIRAAIKLGVAKVNVNTECQIAFA
NATRKFAAEYEANEAEYDKKKLFDPRKFLKPGFEAITEAVEERIDVFGSEGKA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgtttcagcagaaaaatttgtccaagcagctcgtgataatggttatgctgtc
ggtggatttaacactaacaaccttgaatggactcaagctatcttgcgtgcagcagaagct
aaaaaagctcctgttctcattcaaacttctatgggtgctgccaaatatatgggtggttat
aaactttgtaaagttcttatcgaaactcttgtagaatcaatgggaatcactgtaccagtt
gctatccaccttgaccatggtcattatgaagatgctcttgaatgtatcgaagttggctat
acttcaattatgtttgatggttctcatcttccagttgaagaaaaccttgaaaaagctaaa
gaagttgttgcaaaagcacatgctaaaggtatttcagtagaagctgaagttggtactatc
ggtggtgaagaagatggtatcatcggccgcggtgaattggcaccaattgatgacgctaaa
gcaatggtcgaaaccggtattgatttcttggcagctggtattggtaatattcacggtccg
tacccagcaaattgggaaggtcttgaccttgatcacttgaaaaaattgacagaggctgtt
ccaggtttcccaattgtacttcacggtggttcaggtattcctgatgaccaaatccgcgca
gcaattaaacttggtgttgccaaagttaacgttaatactgaatgtcaaatcgcatttgct
aatgctacacgtaaatttgctgctgaatacgaagcaaatgaagcagaatacgacaagaaa
aaactctttgacccacgtaaattcttgaaaccaggttttgaagctattacagaagcggtt
gaagaacgtattgatgtctttggttcagaaggtaaagcttaa

DBGET integrated database retrieval system