KEGG   Streptococcus mutans UA159-FR: SMUFR_0098Help
Entry
SMUFR_0098        CDS       T03797                                 

Gene name
frmA
Definition
(GenBank) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua00010  Glycolysis / Gluconeogenesis
smua00350  Tyrosine metabolism
smua00625  Chloroalkane and chloroalkene degradation
smua00626  Naphthalene degradation
smua00680  Methane metabolism
smua01100  Metabolic pathways
smua01110  Biosynthesis of secondary metabolites
smua01120  Microbial metabolism in diverse environments
smua01130  Biosynthesis of antibiotics
smua01200  Carbon metabolism
smua01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMUFR_0098 (frmA)
  09102 Energy metabolism
   00680 Methane metabolism
    SMUFR_0098 (frmA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMUFR_0098 (frmA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SMUFR_0098 (frmA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMUFR_0098 (frmA)
   00626 Naphthalene degradation
    SMUFR_0098 (frmA)
Enzymes [BR:smua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMUFR_0098 (frmA)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     SMUFR_0098 (frmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Met_10 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AJD54574
Position
complement(119442..120560)
Genome map
AA seq 372 aa AA seqDB search
MNTIKTRAAVAWAPNEPLKIEELDLMMPQKGEVMVHITATGVCHTDAYTLSGKDAEGVFP
CVLGHEGAGIVEAVGEGVTEFQVGDHVIPLYTAECGKCEFCLSGKTNLCSAVRETQGRGV
MPDGTVRFFKDGQPIYHYMGTSTFAEHTVVSEYSLVKIQDNAPLEEVCLLGCGVTTGMGA
VLNTAKVEEGATVAIFGLGGIGLAAIIGARMAKASRIIAIDINPDKFDKARKLGATDLVN
PNNHAKPIQEVIIDITNGGVDYSFECIGNVEVMRAALECCHKGWGESTIIGVAPAGAEIH
TRPFQLVTGRVWRGSAFGGVKGKTQLPGIVGQYMAGEFALSDFITHTMPLEQINDAFDLM
HEGKSIRTVIHY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatcaaaacacgagcagcagttgcttgggcacccaatgaacccttgaaaatt
gaagagttggacctgatgatgccacaaaagggagaggttatggtgcatattacagcgaca
ggagtctgtcataccgatgcctataccctatcaggaaaagatgcagaaggggttttccct
tgcgttttgggacatgaaggtgctggtatcgttgaagcagtgggcgaaggcgtaacagag
tttcaggtcggtgatcatgtgatcccgctttatacagccgaatgcggtaaatgtgagttc
tgcctttcaggaaagaccaacctatgctcagccgttcgtgagacacaaggccgcggtgtc
atgcctgacgggacagttcgtttctttaaggatggtcaacctatttatcattatatggga
acctcaacatttgcagaacatactgttgtttcagagtattctttggttaaaatacaggac
aatgcgccgcttgaagaagtctgtttgctgggctgcggtgtaacaactggcatgggggct
gttttgaatacagctaaagtcgaagagggagcaactgtggccatttttggtctaggcggt
atcggactagctgctattattggtgctcgtatggctaaagcctctcgaatcattgctatt
gatattaatcccgataagtttgacaaggctagaaaattgggagctaccgatttagtcaat
cccaataatcatgctaaaccaattcaggaagtcattattgacataaccaacggcggtgtt
gattattcctttgaatgtatcggaaacgtagaagtcatgcgggctgccttggaatgctgc
cacaagggttggggagagagtactatcatcggtgtagcaccagctggtgctgaaattcat
actcgtccatttcaattggttacaggtcgtgtctggcgtggttcagctttcggtggtgtt
aaaggcaaaacacagctgccgggaattgttggacaatatatggctggcgagtttgcattg
agtgattttattacccataccatgcctctagagcagattaacgatgcctttgacttgatg
catgaaggcaaatctattcgcacagtcattcattactga

DBGET integrated database retrieval system