KEGG   Streptococcus mutans UA159-FR: SMUFR_1035Help
Entry
SMUFR_1035        CDS       T03797                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
smua  Streptococcus mutans UA159-FR
Pathway
smua00051  Fructose and mannose metabolism
smua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SMUFR_1035
Enzymes [BR:smua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SMUFR_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AJD55506
Position
complement(1121649..1122797)
Genome map
AA seq 382 aa AA seqDB search
MKKAVHFGAGNIGRGFIGQILFENGFAIDFVDVNDKIINALNERHSYDIEIAEDGKRHIT
VSNVAGINNKENPQAVIDAVAETELITTAIGPNILPFIAQLIAKGIEKRRESQNQTPLDI
IACENMIGGSAFLWQEVQKYLSADGLAFAKDYIGFPNAAVDRIVPAQVHEDPLFVVVEPF
SEWVVETAAMKNPDLKLSSVHYEENLEPFIERKLFSVNSGHATTAYTGAYFGAKTVLEAL
KDQQVKEQVKAVLGEIRQLLMAKWQFKENDLKVYHDIIISRFENPYIVDDVTRVARTPIR
KLGYDERFIRPIRELKDRGLSYEYLLQTVAYVFHYKDSNDEQSVQLKLLLQEKSLKAVVK
EVTGLTDAALIEEIVTSVESLD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagtacattttggagcaggcaatattggccgtggttttattggacaaatt
ttatttgaaaatggctttgctattgattttgtcgatgttaacgataaaattattaatgct
cttaatgaacgtcattcttatgatattgaaattgcagaagatgggaaacgtcacattaca
gtttctaatgttgctggcattaataacaaggaaaatcctcaagcagtcattgatgctgtg
gctgaaacagagttgattacaaccgctattggccctaacattttgccttttattgcccaa
ttaattgccaaaggtattgaaaaacgccgtgaaagtcagaatcaaacgccactggatatc
attgcctgtgaaaatatgattggtggctctgcctttctctggcaggaagtgcagaaatac
ctcagcgctgatggtttagcttttgctaaagattatattggctttccaaatgctgctgtt
gaccgtattgttccagctcaggttcatgaagatcccctctttgttgtggttgagccattt
tcagaatgggtagtcgaaactgctgctatgaaaaatcctgatttaaaattgtcttcagtt
cactatgaagaaaatttggaaccattcattgaaagaaagcttttctctgttaattcaggt
catgcaacaacagcttatacaggtgcttattttggtgctaagacggtcctagaagcactt
aaagaccaacaagttaaagagcaagtaaaggcagttttaggtgaaattcgccagctttta
atggctaaatggcaattcaaagagaatgatctgaaagtttatcatgatattattatcagt
cgttttgaaaatccttatattgtagatgatgttactcgtgttgccagaacaccaattcgt
aagttaggttatgatgaacgctttatccgtcccattcgtgagctgaaagatcgtggttta
tcttatgaatatcttttgcaaacagtggcttatgttttccattacaaggattcaaatgat
gaacaaagtgttcaacttaaactgcttctacaagaaaagtctttaaaagcagttgttaaa
gaagtaacaggattgacagatgccgctttgattgaagaaattgttaccagtgttgaatct
ttagattaa

DBGET integrated database retrieval system