KEGG   Sulfurospirillum multivorans: SMUL_0536Help
Entry
SMUL_0536         CDS       T03049                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen-III oxidase 1
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
smul  Sulfurospirillum multivorans
Pathway
smul00860  Porphyrin and chlorophyll metabolism
smul01100  Metabolic pathways
smul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMUL_0536 (hemN)
Enzymes [BR:smul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     SMUL_0536 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHJ11811
UniProt: W6EMQ3
Position
513760..515133
Genome map
AA seq 457 aa AA seqDB search
MIDFDKFAKYSKAGPRYTSYPTAPEFHESFTCKSYEDVLATQDKSRKLSLYFHLPFCRSA
CYFCGCNVVYTSKEDKKERYIDYLVRELELLSKHLDTSREVIQMHFGGGTPTFFSTAQLE
RIIGAIKSHFKNFAKDAEISCEIDPRYLTKEQLDVLTCNGFNRVSYGVQDFNDEVQKAIH
RIQPYDVTANVVKMAKSAGIKSINMDLIYGLPYQTFETFKETLRLAVSLDPSRLAVFNYA
HVPWMKKTMRKIDETTLPLPSVKLAIMRYTIDYLESNGYKMIGMDHFAKPDDELFLAIEK
GELHRNFQGYTTKGGADLIGIGLTSIGEGLSHYVQNFKEMDAYENAIDAGVLPVHRGLTL
NDDDVLRKAVIMEMMSNFKLNIAGIEQAFGIDFFDYFADAIKALEPFEQEELVVVDRVAK
KIFVNTTGTLLIRNIVMPFDAYLQKIPEDKRRFSKTV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttgataaatttgccaagtactccaaagcgggtcctaggtacacgagttac
ccaacagcgcccgagtttcatgagagctttacatgtaaaagttatgaggacgtcttggca
acccaagataagagtcgtaaactctcgctttattttcaccttcctttttgccgaagtgcc
tgttatttttgtggctgtaacgttgtttacaccagcaaagaggataaaaaagagcgctac
attgactatcttgtgcgcgaacttgagcttctctctaaacaccttgatacgtcgcgtgaa
gtgattcagatgcactttggtggcggtacaccaacctttttcagcacagcacagttagag
cgcattattggcgctatcaaaagccacttcaaaaactttgcaaaagatgctgaaatcagc
tgtgagatcgacccgcgttacttaaccaaagagcagttagatgtgcttacatgtaacggg
tttaaccgcgtgagttatggcgttcaagactttaacgatgaggttcaaaaagcgatccac
cgcattcaaccgtacgatgtgactgccaatgtggtaaagatggcaaaaagcgcaggtatt
aagtcgatcaatatggatttgatctacggtcttccgtatcaaacctttgagacgtttaaa
gagacattacgtcttgccgtttcgcttgatccaagccgtttggcggtgtttaactacgcc
catgtgccgtggatgaaaaaaacaatgcgcaagatcgatgagacaacgcttccgctccca
agtgtcaagcttgccattatgcgctatacgattgattatttagagtccaatggctacaaa
atgatcggtatggatcactttgctaagcctgatgatgagcttttcttagcgattgaaaaa
ggcgaattgcaccgcaatttccaaggatatacgaccaaaggtggcgcagacttgatcggc
attggtttgacgagcatcggtgaaggcttgagtcactacgtgcaaaacttcaaagagatg
gatgcatacgaaaacgccatcgatgcgggtgttttgccagtacatcgtgggctaacactt
aatgatgacgacgtacttagaaaagcggtcatcatggagatgatgagcaactttaagctc
aatatcgctggcattgagcaagcatttggcattgacttctttgactattttgccgatgcg
attaaagcacttgagccttttgagcaagaagaattagtcgttgtggatagagttgctaaa
aagattttcgtcaataccacaggcacactgctcattcgcaacattgtgatgccttttgat
gcgtacctccaaaaaatccctgaagataaacgacgcttcagtaaaacggtgtaa

DBGET integrated database retrieval system