KEGG   Simonsiella muelleri: BWP33_00150Help
Entry
BWP33_00150       CDS       T05344                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
smur  Simonsiella muelleri
Pathway
smur00740  Riboflavin metabolism
smur00790  Folate biosynthesis
smur01100  Metabolic pathways
smur01110  Biosynthesis of secondary metabolites
smur02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BWP33_00150
   00790 Folate biosynthesis
    BWP33_00150
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BWP33_00150
Enzymes [BR:smur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BWP33_00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 Phlebovirus_G1
Motif
Other DBs
NCBI-ProteinID: AUX60397
UniProt: V9HMM7
Position
29508..30107
Genome map
AA seq 199 aa AA seqDB search
MNSNIIQHITSCRLPTEYGVFQMHGFVDTRSNQEHTALVMGDVADGNAVLSRIHSECLTG
DALFSQKCDCGAQLQAAMQAVQAEGRGVIVYLRQEGRGIGLINKIRAYALQDQGLDTVEA
NLALGLPVDARDFSIAKYIYEHLGVQSVRLLTNNPEKIQTLRDCGIEIVERIPLKVGENP
ENIGYLNTKADKLHHLLKD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaatattattcagcacattacatcttgtcgcctacccacagagtatggcgtt
tttcaaatgcatggttttgtggacacgcgcagtaaccaagagcataccgcacttgtgatg
ggcgatgtggcggacggcaatgcggtgttgtcgcgcattcattcggaatgtttgacgggc
gatgcgttgttttcgcaaaaatgcgattgtggtgcacaacttcaggctgccatgcaagcc
gtgcaagcagaagggcgcggcgtgattgtgtatttgcgccaagaagggcgtggcattggc
ttgattaataaaattcgcgcttatgctttgcaagaccaaggtttggacacggtggaagcc
aatttggcattgggattgcctgttgatgcgcgtgattttagtattgccaaatatatttat
gaacatttgggcgtacaatctgtgcgtttgttgaccaataatcccgagaaaattcagacg
ttgcgtgattgtggcattgaaattgtggagcgaattccgttgaaagtcggcgaaaatcca
gaaaatatcggttatttgaatacaaaagcagataaattacatcatttgttaaaggactga

DBGET integrated database retrieval system