KEGG   Simonsiella muelleri: BWP33_04440Help
Entry
BWP33_04440       CDS       T05344                                 

Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
smur  Simonsiella muelleri
Pathway
smur00540  Lipopolysaccharide biosynthesis
smur01100  Metabolic pathways
Module
smur_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:smur00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BWP33_04440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:smur01005]
    BWP33_04440
Enzymes [BR:smur01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BWP33_04440
Lipopolysaccharide biosynthesis proteins [BR:smur01005]
 Unusual sugar
  BWP33_04440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short Ldh_1_N DapB_N
Motif
Other DBs
NCBI-ProteinID: AUX61130
UniProt: V9HCF1
Position
complement(904167..905171)
Genome map
AA seq 334 aa AA seqDB search
MTIIVTGAAGFIGSNLVKALNQRGITDIIAVDNLSKGDKFHNLADCEIAHYLDKHEFIQL
VRDHHFLKMDIDAVLHQGACSDTMNHDGKYMMENNYQYTLDLLDWCQFERIPFIYASSAA
VYGKGEVFREERPLEKPLNVYGYSKFLFDQILRQRIHAGLTSQVVGLRYFNVYGMREQHK
GRMASVAYHHFNQYREQGFVNLFGEYGGYGKGEHSRDFISVEDIVKVNLFFLDNPDKSGI
FNVGTGRSQPFNDLAAATVNACRVAAHQSPLSLTELVAQKLIRYVDFPDALVGKYQSFTQ
ADITQLRLAGYTDDFLTVEQGVERYVAWMLENLG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtaacgggtgcggctggtttcatcggcagtaatttagttaaagcattg
aatcaacgtggtattaccgatatcattgcggtggataatttgagcaaaggcgataaattc
cacaatttagctgattgtgaaattgcccattatttagataaacatgaatttatccaattg
gtgcgcgaccatcattttttgaaaatggacatagatgcggttttgcatcagggggcgtgt
tctgacaccatgaatcacgatggtaagtatatgatggaaaataactatcagtacacattg
gatttattggactggtgtcaatttgagcgcattccattcatttacgcttccagcgcggcg
gtatacggcaaaggcgaagtgttccgcgaagaacgccctttggaaaaaccattaaatgtt
tatggctactcaaaatttttgtttgaccaaattttgcgtcaacgcatacacgcaggtttg
acttcgcaggtggttggcttacgttattttaatgtttacggaatgcgcgaacaacataaa
ggacgaatggcatcagtagcttatcatcattttaatcaataccgtgaacaaggctttgtt
aatttatttggtgaatacggtggttacggtaaaggtgaacacagccgcgattttattagc
gtggaagacattgttaaagtgaatttatttttcttagataatcctgataaatcaggaatt
ttcaatgttggcacgggacgtagtcagccgtttaatgatttggcggcagcaaccgtgaat
gcgtgtcgtgtggctgcccatcagtcgccactttcattgacggaattggtggcacaaaaa
ttgattcgctacgttgattttcccgatgcgctggttggcaaataccaatcgttcacgcaa
gccgatatcacgcaattacgtttggcaggctataccgatgattttctcacggtagaacaa
ggtgttgaacgttatgtcgcgtggatgttggaaaatctagggtag

DBGET integrated database retrieval system