KEGG   Simonsiella muelleri: BWP33_06930Help
Entry
BWP33_06930       CDS       T05344                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
smur  Simonsiella muelleri
Pathway
smur00471  D-Glutamine and D-glutamate metabolism
smur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smur00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BWP33_06930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smur01011]
    BWP33_06930
Enzymes [BR:smur01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BWP33_06930
Peptidoglycan biosynthesis and degradation proteins [BR:smur01011]
 Precursor biosynthesis
  Racemase
   BWP33_06930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race XPG_I
Motif
Other DBs
NCBI-ProteinID: AUX62587
Position
complement(1417931..1418740)
Genome map
AA seq 269 aa AA seqDB search
MSPNNEKPIGVFDSGVGGLTVVRALMERLPNENIVYFGDTARVPYGVKSRNTIEEFTAQI
VEFLLQNEVKALVIACNTIAAVAYKRVQQMVGNMPIISVIEAGAQAALATTRNNHIGVIA
TSTTVNSNAYARAIHAQNPDTRILSQASPILVPLVEEGWLDHEVTRLTVREYLKPILAED
VDTLVLGCTHYPLLKPLIKKEANTLELVDSSITTAEATAQALLDAHLLNTSQQMPDYRFY
VSDIPLRFQTIGERFLGRSLEQIEMMRLG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgaacaacgaaaaaccgattggcgtttttgattcgggtgtgggcggtttaacc
gtggtccgcgctttgatggaacgcttgcccaatgaaaacattgtctattttggtgatact
gcgcgtgtaccctatggcgtaaaatcgcgtaacacaattgaagaatttaccgcacaaatt
gttgaatttttattgcaaaatgaagtcaaagcccttgtgattgcatgcaataccattgct
gccgttgcctacaaacgtgtacaacaaatggtgggcaatatgcccataatcagcgtcatt
gaagcaggcgcacaagccgcacttgccaccacgcgcaacaaccatattggcgtgattgcc
accagtaccacagtaaacagcaacgcctacgctcgcgccattcacgcacaaaaccccgat
actcggattttgtcgcaagctagccctattctcgtgccattggtcgaagaaggttggctc
gatcacgaagtaacgcgcctaaccgtacgcgaatatttgaagcccattttggcagaagat
gtggacacactggtgctgggttgcacccactatccattacttaaaccattgattaaaaaa
gaagccaatacattagaattggtggattcttccatcacaaccgccgaagccaccgcacaa
gctttgttggatgcccatttgctcaacaccagccaacaaatgcccgattaccgcttttat
gtatctgatattccattgcgatttcagacgattggcgaacgatttttgggacgcagttta
gaacaaattgagatgatgcggttgggttga

DBGET integrated database retrieval system