KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_02350Help
Entry
SMUGS5_02350      CDS       T02185                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smut01100  Metabolic pathways
smut01110  Biosynthesis of secondary metabolites
smut01130  Biosynthesis of antibiotics
smut01230  Biosynthesis of amino acids
Module
smut_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMUGS5_02350 (trpC)
Enzymes [BR:smut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SMUGS5_02350 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFM80997
Position
493172..493939
Genome map
AA seq 255 aa AA seqDB search
MTKEFLPTILKQKQEELASLIMEEVKPLRLTYRLFDFLKEHQDQLQIVAEVKKASPSMGD
INLDVDIVKQAQMYEAAGAAMISVLTDQVFFKGNIDFLAEISGGVSIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVAALPEKRLKELYDFASGLGLEVLVETHNLSELEIAHRIGAQIIG
VNNRNLVTFEVDINTSLELSTHFRDDKVYISESGIFTGQDSKLVAPYFNAILVGTALMQA
DNVADKVKELAIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaagagtttttacctactattttaaagcaaaaacaagaagagctagctagtcta
attatggaagaagtcaaaccgcttcgcttaacctatcgtctctttgattttttaaaagag
catcaagaccagttgcagattgttgctgaagttaaaaaagctagtcccagtatgggagac
atcaacttagatgttgacattgtcaaacaagcccaaatgtatgaagccgctggagctgct
atgatttctgttttgacagatcaggtttttttcaagggaaatattgattttttggctgag
atatctggcggtgtcagtattccgaccttggctaaagattttattattgatgagaagcag
attgttcgtagccgtaatgctggtgcgacagttattttgctcattgtggccgctttacca
gagaagagactgaaggaattgtatgactttgcttcaggtttaggactagaagttttagtg
gagacccataatttgtctgaattggaaatagctcatcgtattggagcacagattatcggt
gtcaataatcgtaatcttgttacttttgaagtagatatcaataccagcttggagttatct
acccatttccgagatgataaggtttatatttccgaatcaggtatttttacgggacaggac
agtaaactcgtcgctccttactttaatgctattcttgtaggaacggctctcatgcaggca
gataatgtcgctgataaagtaaaggagttggctattgacaaaggttaa

DBGET integrated database retrieval system