KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_04540Help
Entry
SMUGS5_04540      CDS       T02185                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00620  Pyruvate metabolism
smut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMUGS5_04540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smut02000]
    SMUGS5_04540
Enzymes [BR:smut01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SMUGS5_04540
Transporters [BR:smut02000]
 Other transporters
  Primary active transporters [TC:3]
   SMUGS5_04540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like His_biosynth ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFM81429
Position
964762..966153
Genome map
AA seq 463 aa AA seqDB search
MTKIHIMETVLRDGQQSQIATRMTTKEMLPVLKTLDEAGYHALEMWGGATFDSCLRFLNE
DPWERLRTIRKHIKKTKLQMLLRGQNLLGYRNYADDVVCSFIQKSVENGIDIVRIFDALN
DPRNLQTAVSATKEAGGHAQVAISYTTSPVHTVDYFVHLSKEYAEIGADSICIKDMAGVL
TPQTGYDLVKRIKEAVDLPLEVHTHATSGISEMTYLKVAEAGADIIDTAVSSFAGGTSQP
ATESIVIALEELGFETGVDLQKVETAAAHFNTIRDHYRAEGLLNPKVKDVEPKTLIYQVP
GGMLSNLLSQLTEQGLANRYEEVLAEVPRVRADLGYPPLVTPLSQMVGTQSLLNIISGER
YKVVPNEIRDYVRGLYGRPPAAIADDIKEKIIGDEEVITVRPADLIEPQLPKLRQEIAEY
ARSEEDVLSYASFPQQSKDFLGRREDPFYDVPVQNVSVTIDFD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatccatattatggagacggttttaagagacgggcagcaaagtcaaattgca
acacgaatgacaactaaagaaatgttacctgttcttaaaactttggatgaagctggatat
catgctttagagatgtggggtggagcgacctttgattcctgccttcgttttttaaacgag
gatccatgggaaagattgcgtactattcgtaaacatattaaaaagacaaaattgcagatg
ttactgcgtggtcaaaatttattgggctaccgcaattatgctgacgatgttgtttgctct
ttcattcaaaaatcagttgaaaatggtattgatatcgtccgtatttttgatgctttgaat
gatccgcgtaatctacaaacggcagttagtgctactaaggaagctggcggacatgctcaa
gtggctatttcttatacaactagtcccgttcatacagttgattattttgttcatttatct
aaagaatatgctgaaatcggagcagactccatttgtatcaaggatatggctggtgtttta
acacctcaaacaggttatgaccttgtaaagcgtatcaaagaagcggttgatttgccacta
gaagtacatactcatgcgacaagtggtatctctgaaatgacttatcttaaggttgcagaa
gctggtgctgatattattgatactgctgtatcttcctttgcaggcggaactagtcaacca
gcgacagaatctatagttatcgctttagaagaacttggttttgaaacaggtgttgatcta
cagaaagttgagacagcagcagcacacttcaatactatccgtgatcattatcgtgcagaa
ggtcttttaaatcctaaggttaaggatgttgagcctaaaactttgatttatcaagttcca
ggcggtatgttgtctaatttgcttagtcaattaacagaacagggattggccaatcgctat
gaagaagtgttggccgaagttcctcgtgttagagccgatttgggctatccgccattggtt
acacctttatcgcaaatggttgggacacaatctctactgaacattatctctggtgaacgc
tataaagttgttcctaacgaaattagggattatgttcgtggactttatgggcgtccacct
gcagccattgccgatgatattaaagaaaaaatcattggggatgaagaagtgattactgtt
cgtccagcagatttaatcgagcctcaattacctaaacttagacaggaaattgctgaatat
gcaagaagtgaagaagatgttttaagttacgcttctttcccgcaacaatctaaagatttc
ttagggcgtcgtgaagatcccttctacgatgtacctgtacaaaatgtttctgttaccatt
gattttgattaa

DBGET integrated database retrieval system