KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_05255Help
Entry
SMUGS5_05255      CDS       T02185                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00051  Fructose and mannose metabolism
smut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SMUGS5_05255
Enzymes [BR:smut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SMUGS5_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AFM81562
Position
complement(1104114..1105262)
Genome map
AA seq 382 aa AA seqDB search
MKKAVHFGAGNIGRGFIGQILFENGFAIDFVDVNDKIINALNERHSYDIEIAEDGKRHIT
VSNVAGINNKENPQAVIDAVAETELITTAIGPNILPFIAQLIAKGIEKRRESQNQTPLDI
IACENMIGGSAFLWQEVQKYLSASGLAFAKDYIGFPNAAVDRIVPAQVHEDPLFVVVEPF
SEWVVETAAMKNPDLKLSSVHYEENLEPFIERKLFSVNSGHATTAYTGAYFGAKTVLEAL
KDQQVKEQVKAVLGEIRQLLMVKWRFKENDLKVYHDIIISRFENPYIVDDVTRVARTPIR
KLGYDERFIRPIRELKDRGLSYEYLLQTVAYVFHYKDSNDEQSVQLKMLLQEKSLKAVVK
EVTGLTDAALIEEIVANVESLD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagtacattttggagcaggcaatattggtcgtggttttattggacaaatt
ttatttgaaaatggctttgctattgattttgtcgatgttaacgataaaattattaatgct
cttaatgaacgtcattcttatgatattgaaattgcagaagatgggaaacgtcacattaca
gtttctaatgttgctggcattaataacaaggaaaatcctcaagcagtcattgatgctgtg
gctgagacagagttgattacaaccgctattggccctaacattttgccttttattgcccaa
ttgattgccaaaggtattgaaaaacgtcgtgaaagtcagaatcaaacgccactggatatc
attgcctgtgaaaatatgattggtggctctgcctttctctggcaggaagtgcagaaatac
ctcagcgctagtggtttagcttttgctaaagattatattggctttccaaatgctgctgtt
gaccgtattgttccagctcaggttcatgaagatcccctctttgttgtggttgagccattt
tcagaatgggtagtcgaaactgctgctatgaaaaatcctgatttaaaattgtcttcagtt
cactatgaagaaaatttggaaccattcattgaaagaaagcttttctctgttaattcaggt
catgcaacaacagcttatacaggtgcttattttggtgctaagacggtcctagaagcactt
aaagaccaacaagttaaagagcaagtaaaggcagttttaggtgaaattcgccagctttta
atggttaaatggcgattcaaagagaatgatctgaaagtttatcatgatattattatcagt
cgttttgaaaatccttatattgtagatgatgttactcgtgttgccagaacaccaattcgt
aagttaggttatgatgaacgctttatccgtcccattcgtgagctgaaagatcgtggttta
tcttatgaatatcttttgcaaacagtggcttatgttttccattacaaggattcaaatgat
gaacaaagtgttcaacttaaaatgcttctacaagaaaagtctttaaaagcagttgttaaa
gaagtaacaggattgacagatgccgctttgattgaagaaattgttgccaatgttgagtct
ttagattaa

DBGET integrated database retrieval system