KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_07075Help
Entry
SMUGS5_07075      CDS       T02185                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00520  Amino sugar and nucleotide sugar metabolism
smut00550  Peptidoglycan biosynthesis
smut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SMUGS5_07075
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMUGS5_07075
Enzymes [BR:smut01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SMUGS5_07075
Peptidoglycan biosynthesis and degradation proteins [BR:smut01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SMUGS5_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFM81910
Position
complement(1501103..1502362)
Genome map
AA seq 419 aa AA seqDB search
MRKIVINGGKPLKGEVAVSGAKNSVVALIPAIILADDIVTLDGVPAISDVDSLIDIMTLM
GASVECDGDSLKIDPRGVKDIPMPYGKINSLRASYYFYSSLLGRFGRAVVGLPGGCDLGP
RPIDLHLKAFKAMGATVSYEGEAMRLSTEGKPLKGAHIYMDTVSVGATINTMIAASKAQG
RTVIENAAREPEIIDIATLLNNMGAHIRGAGTDMIIIEGVEKLHGTRHQVIPDRIEAGSY
IALAAAVGEGIKVTNVLYEHLESFISKLEEMGVRMTIEEDSVFVEKQDKLKAVSIKTSPY
PGFATDLQQPITPLLLTAVGRGKIRDTIYEKRVNHVAELARMGAKISVLGGQIIYEGPNE
LSGAPVKATDLRAGAALVTAGLMAKGQTVITNIEFILRGYSDIIQKLNRLGADIEIVEE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgtcattaatggtggtaagcccttaaagggggaggttgcggtctcagga
gctaaaaacagtgttgtcgctctgattccagctattattttagcagatgatattgtcaca
cttgatggtgtgccagctatcagtgatgttgatagtttaattgacattatgactttaatg
ggagcaagtgttgagtgtgatggtgacagtcttaaaattgatccacgcggtgtaaaggat
attcccatgccttatggcaagattaatagtttaagagcttcatattatttttacagtagt
ttgctgggacgttttggtcgggcggtcgttggtttgcccggtggctgcgatttgggacct
cgtccgattgatttgcatctcaaggcctttaaagcaatgggagcaacggtttcctatgaa
ggagaggctatgcgcctttcaaccgaaggcaagccgcttaagggggctcatatttatatg
gatactgtcagtgttggagcaacgattaatacgatgatagctgctagtaaggcacaagga
cgtaccgttattgagaatgctgcgcgtgagccagaaattattgatattgcaacgctttta
aataatatgggagcccatatccgcggggcaggaacggatatgattatcatagaaggtgtt
gaaaaacttcatggaacgcgtcatcaagtcattcctgaccgcattgaagctggttcttac
attgctttggcagctgctgttggtgaaggaatcaaggttaccaatgtgctttatgaacat
ttggagagtttcatttcaaagctggaagaaatgggcgtgcgtatgactattgaagaagac
agtgtttttgttgaaaagcaggacaaattaaaggcagtttccattaagacttcgccttat
cccggttttgcgactgatctgcagcagcccataacaccgctattattaacagctgtaggc
cgcggaaagattcgtgatactatctatgaaaaacgggttaatcatgtggctgaattggca
cgtatgggagctaagatttctgtcttaggcggtcaaattatctatgaaggacccaatgaa
ttaagtggagctcctgttaaagcaaccgatttacgtgcgggagcagcacttgttacggca
ggattaatggcaaaaggtcaaacggttattacgaatattgaatttatcttgcgcggttat
tctgacattattcaaaaattgaatcgtctaggtgcggatatcgaaattgttgaagaataa

DBGET integrated database retrieval system