KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_08675Help
Entry
SMUGS5_08675      CDS       T02185                                 

Definition
(GenBank) peptidase, AtmC, ArgE/DapE/Acy1 family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smut  Streptococcus mutans GS-5 (serotype c)
Pathway
smut00300  Lysine biosynthesis
smut01100  Metabolic pathways
smut01120  Microbial metabolism in diverse environments
smut01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smut00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SMUGS5_08675
Enzymes [BR:smut01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SMUGS5_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFM82208
Position
complement(1799484..1800857)
Genome map
AA seq 457 aa AA seqDB search
MAFSSEQEQIAKFWQDEVAQHYFEVLRTLISKKSIFAQQIGLQDVAGYLGEIFANVGAEV
TIDETYTAPFVIAKFKSSKPQAKTIIFYNHYDTVPADNDQIWTDNPFKLTLRKGYMYGRG
VDDDKGHITARLTAVRKYIREVGDLPVNVTFIIEGAEESASTDLDKYLKKYADSLLPADV
LIWEQGVKNSQGQLEITGGNKGIITFNLSVSSAEVDIHSKYGAVIESAAWYLLNAISSMR
ADDGQILIDGIYDQVLKPNERELDLVERYALENSEGLRKVYGLKLPTLKKERRDFLKTYF
FEPALSIEGLSSGYQGQGVKTILPSAASAKMEMRLVPGLSPQYVFEKINSHLRKLGFEHV
KVTYTLGEESYRSDMSAPAILTIIDLAKQFYEAGVSVLPTAAGTGPMHTVYDALGIPMLA
FGLGNPNSRDHGGDENVNLADYYTHIELIKELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcaagtgaacaagagcaaattgctaaattttggcaggatgaagttgctcag
cattattttgaggttttacggaccttaatttccaaaaaatctatttttgcacaacagata
ggcctgcaggatgttgcaggctatttgggcgaaatttttgccaatgtcggtgctgaagtg
acaattgatgaaacctatacggctccttttgttattgctaaatttaaaagttccaaacct
caggctaaaaccattattttttataaccattatgatacagtacctgcagataatgatcag
atttggacagataatccctttaaactgactttaagaaaggggtatatgtatggccgcggt
gttgatgatgacaaagggcatattacagctcgtttgacagctgttcgaaagtatattcgt
gaggttggggaccttcctgttaatgttacttttataatagaaggagctgaagaatctgct
tcaacagatcttgacaagtatttaaaaaaatatgcggatagtttgcttcctgcagatgtt
ttgatttgggaacaaggtgttaaaaatagtcagggtcagttagaaattacaggtggtaat
aaaggtattattacttttaatctttctgtatccagtgcagaggttgatattcactcaaaa
tatggtgcggttattgaatcggcagcatggtatctcttaaatgcaatttccagtatgcga
gcagatgatggtcagattttaatcgatggtatttatgatcaggtcttgaagcccaatgag
cgtgaattggatttagtagagcgttatgctcttgaaaatagtgaaggtttgcgcaaagtt
tatggtttaaaattaccaactttaaaaaaagagcgtcgtgattttcttaaaacctatttt
tttgaacccgccttatccatagaaggactttcttctggttatcaagggcaaggtgtgaaa
acaattctgccttctgctgccagtgctaagatggaaatgcgtttagttcccggtctcagt
ccccagtacgtttttgaaaagattaatagtcatttgagaaaattaggctttgaacatgtt
aaggtaacctataccttaggcgaagaatcttatcgcagtgatatgagtgctccggctatt
ttgaccattattgacttggctaagcaattttatgaagctggcgtatctgttctgcccact
gctgctggtacaggtcctatgcatacggtttatgatgctttgggcattcctatgttagct
tttggacttggcaatcccaatagtcgcgatcacggtggtgatgaaaatgttaatttagca
gactattatacccatattgaattaattaaggagttaattagaagttatgagtaa

DBGET integrated database retrieval system