KEGG   Serratia marcescens WW4: SMWW4_v1c04190Help
Entry
SMWW4_v1c04190    CDS       T02448                                 

Gene name
basS
Definition
(GenBank) sensory histidine kinase in two-component regulatory system with BasR
  KO
K07643  two-component system, OmpR family, sensor histidine kinase BasS [EC:2.7.13.3]
Organism
smw  Serratia marcescens WW4
Pathway
smw01503  Cationic antimicrobial peptide (CAMP) resistance
smw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMWW4_v1c04190 (basS)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SMWW4_v1c04190 (basS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smw01001]
    SMWW4_v1c04190 (basS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:smw02022]
    SMWW4_v1c04190 (basS)
Enzymes [BR:smw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SMWW4_v1c04190 (basS)
Protein kinases [BR:smw01001]
 Histidine kinases
  OmpR family
   SMWW4_v1c04190 (basS)
Two-component system [BR:smw02022]
 OmpR family
  BasS-BasR (antimicrobial peptide resistance)
   SMWW4_v1c04190 (basS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGE16226
Position
complement(475689..476750)
Genome map
AA seq 353 aa AA seqDB search
MISMRRRLLLMLALILLVTQLISAFWLWHESQEQISFLVDETLSAKVRTERVDTEIAEAI
ASLLAPSLIMMIVTLLASFWAISWIIRPLNQLQQRLEKRSADNLTPLPITSDSQEMVAVT
NALNQLFSRLDNTIQQERLFTADAAHELRTPLAGIRLHLELMEKQGVKGSQALIARIDQL
MHTVEQLLMLSRAGQDFASGHYQHFDWVADVIQPLREELDEMAAQRGQTLGWQLPAAATV
NGDPVLLRLLLRNLVENAHRYGPEGGAIQVRLTPQDNGYLLQVIDDGPGIKEEMVGELTQ
AFRRMDQRYGGSGLGLNIVIRIAQLHQGRLTLENRRDARGLNAQCWMPEKALK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcatgcgccgccgcctgctgctgatgctggcgctgatcctgctggtcacgcaa
ctcatcagcgccttctggctgtggcacgaaagccaggagcagatcagcttcctggtggac
gaaaccctgtccgccaaagtgcgtaccgaacgcgtcgataccgagatcgccgaggccatc
gcatcgctgttggcgccttcgctgatcatgatgatcgtcaccctgttggcgtcattctgg
gctatcagctggatcatccgcccactcaaccaactgcaacagcggctggaaaagcgctct
gccgataacctgacgccgctgccgatcaccagcgatagccaggaaatggtggccgtcacc
aatgcgctcaatcagctgttctcacggttggacaacaccattcaacaggaacgcctgttc
accgccgacgccgcccacgaactgcgcacgccgctggccggcatccgcctgcatctggaa
ttgatggaaaaacagggcgtcaagggcagccaggcgctgatcgcccgcatcgatcagctg
atgcataccgtcgagcagttgctgatgctgtcgcgcgccgggcaagacttcgccagcggc
cattatcagcatttcgattgggtggccgatgtgatccagccgctgcgcgaagagctcgac
gaaatggccgcccaacgcgggcagacgctgggctggcaattgccggctgctgccacagtg
aacggcgatccggtgctgctgcggctgctgctgcgcaatctggtcgaaaacgcccaccgt
tacggcccggaaggcggcgcgatacaggtgcggttaacgccgcaagacaacggctatctg
ctgcaggtcatcgacgatggcccgggaatcaaggaagaaatggtcggggagctgacgcag
gcgtttcgccgcatggatcaacgctacggcggcagcggactgggcctgaatatcgtgatc
cgcatcgcgcaactgcaccaggggcgtttgacgctggaaaaccgccgcgatgcgcgcggc
ctgaatgcccagtgctggatgccggaaaaggcgctcaaataa

DBGET integrated database retrieval system