KEGG   Serratia marcescens WW4: SMWW4_v1c05320Help
Entry
SMWW4_v1c05320    CDS       T02448                                 

Gene name
yqeF
Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smw  Serratia marcescens WW4
Pathway
smw00071  Fatty acid degradation
smw00072  Synthesis and degradation of ketone bodies
smw00280  Valine, leucine and isoleucine degradation
smw00310  Lysine degradation
smw00362  Benzoate degradation
smw00380  Tryptophan metabolism
smw00620  Pyruvate metabolism
smw00630  Glyoxylate and dicarboxylate metabolism
smw00640  Propanoate metabolism
smw00650  Butanoate metabolism
smw00900  Terpenoid backbone biosynthesis
smw01100  Metabolic pathways
smw01110  Biosynthesis of secondary metabolites
smw01120  Microbial metabolism in diverse environments
smw01130  Biosynthesis of antibiotics
smw01200  Carbon metabolism
smw01212  Fatty acid metabolism
smw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMWW4_v1c05320 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SMWW4_v1c05320 (yqeF)
   00640 Propanoate metabolism
    SMWW4_v1c05320 (yqeF)
   00650 Butanoate metabolism
    SMWW4_v1c05320 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMWW4_v1c05320 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SMWW4_v1c05320 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMWW4_v1c05320 (yqeF)
   00310 Lysine degradation
    SMWW4_v1c05320 (yqeF)
   00380 Tryptophan metabolism
    SMWW4_v1c05320 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMWW4_v1c05320 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMWW4_v1c05320 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMWW4_v1c05320 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smw04147]
    SMWW4_v1c05320 (yqeF)
Enzymes [BR:smw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMWW4_v1c05320 (yqeF)
Exosome [BR:smw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMWW4_v1c05320 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C Phage_cap_P2
Motif
Other DBs
NCBI-ProteinID: AGE16339
Position
606043..607227
Genome map
AA seq 394 aa AA seqDB search
MQQREVVIVAATRTPVGSFHGALAPLTAVELGTAAVQGLLAQSGVPPQQIDEVILGQVLT
AGCGQNPARQTALNAGLPVTTPALTINKVCGSGLKAVHLAVQAIRSGDADAVIAGGQESM
SQSPYLMAGARAGLRLGHAQMMDSVIHDGLWDAFNDYHMGITAENLAEKYAISREEQDRF
ALRSQQKALAAQQAGRFVQEITPVTVPQPKGEALRVERDQQPRDTSLEALARLRPAFRKE
GTVTAGNASSLNDGAAVVLLMSAEKAAALRLPVLARIAGYASSGVDPAIMGIGPAPAARR
CLEKAGWRLEEVDLIEANEAFAAQALAVGKELGWEAERVNVNGGAIALGHPIGASGCRIL
VSLLFEMQRREVNKGLAMLCIGGGQGVALAVERP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaacgtgaagtggtgatcgtggcggcgacgcgcacgccggtcggcagttttcac
ggcgcgctggcgccgttgacggcggtggaactgggcacggcggcggtgcaggggctgctg
gcgcaaagcggcgtgccgccgcagcagatcgatgaagtgatcctcggccaggtgctgacc
gccggctgcgggcagaatccggcgcgccagaccgcgctcaacgccgggctgcccgttacg
acgccggcgctgaccatcaacaaggtgtgcggctccggtttgaaggcggtgcatctggcg
gtgcaggcgatccgcagcggtgacgccgacgcggtgatcgccggcggtcaggagagcatg
agccagtcgccttacctgatggccggcgcgcgcgccggtctgcgcctcggtcacgcgcag
atgatggacagcgtgatccacgatggcctgtgggacgcgttcaacgactatcacatgggc
atcaccgccgagaacctggcggagaaatacgccatcagcagagaagaacaagacaggttc
gcgctgcgctcgcagcagaaggcgctggcggcgcagcaggccgggcgtttcgtgcaggag
atcacgccggtgacggtgccgcagcccaagggcgaggcgctgcgggtcgagcgtgaccaa
cagccgcgcgacaccagcctggaggcgctggcgcggctgcgcccggcgtttcgcaaagag
ggcacggtgaccgccggcaacgcctcgtcgctcaacgacggcgccgccgtggtgctgctg
atgagcgcggaaaaagccgccgcgctgcgtttgccggtgctggcgcgcatcgccggttac
gcctcgtcgggcgtcgatccggcgatcatgggcatcggcccggcgccagccgcgcgccgc
tgcctggaaaaagccggttggcggctggaggaggtcgatctgatcgaagccaacgaagcc
ttcgccgcgcaggcgctggcggtgggtaaagaactgggctgggaggcggagcgggtcaac
gtcaacggcggagcgatcgcgctggggcatccgatcggcgcgtccggctgccgcattttg
gtgtcgctgctgttcgaaatgcagcgccgcgaggtgaacaaggggctggcgatgctgtgc
atcggcggtgggcagggggtggcgctggcggtagagcgcccgtaa

DBGET integrated database retrieval system