KEGG   Serratia marcescens WW4: SMWW4_v1c06360
Entry
SMWW4_v1c06360    CDS       T02448                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c06360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c06360
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c06360
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AGE16443
Position
706055..708352
AA seq 765 aa
MNRMITVHTSLEDTPFLFQSLTGKEALSSLYTFHVDVLCEAQPVDPKKLLGQTLTVECRQ
TPLTPPRYLSGIMTRVEVKGRDKNDRYDRYTLTVKPALWYLGQGRDCRIWQEKSVPDIIT
TLLREQNIAFENRLSWDYRCWEYCVQYQESDFDFISRLMEHEGIYYYFLHDNGKHTLVLA
DAPEQHEVLSGFATFPCIDETASDVSEPGIAHWRVSETMSASLYLTDDYDFRRPRASLLQ
ARQNPAPDGQQEAVVFDWPGRYTRHDDGAFYGRIRQQELACAQAQMSGETPSLGMAPGHA
FTLTRAARPEDNRTYIVSGAEYFFSEAGYYSQDDEEATPVHRTVFTAHPAALSWRPARQT
AWPRTYGPQTAEVVGPQGQTIWTDEYGRIKLRFRWDRHNAPGNDQAACWVRVSSAWAGWG
YGSIQVPRVGEEVIVDFINGDPDRPIVTGRVYNQDSMPPWDLPADATKMGFMTRSAGGTP
ENGSFLVFDDAPGRETFDMHAERDMSMSTERDLTVNIEGARTTRVKGKDSYTFDDSQRVR
IARGRQVDIAAGGDNREVTGDSTTTLHGKQTVIIDGELVEEYRDGQTTTVTAGGQTLKIH
AGGQTIIISEGGRSIDIVGDAKKKITGNEREDTTGEWTKSVGGTINILSDADVNIKSATK
ITMDAPNQKATTGKGHSESFTGHSFSMTGASESFTGSSVSFTNSSVSFTASSVSMGMFSI
SNTPFKLSKHDNHLEFVSGNKTLTSTLLSLKSDYSAFVSALTTIA
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgaacagaatgataacggtccatacctcgcttgaagatactccctttctttttcaatca
ttgaccggcaaggaagccttgtcatcgctgtatactttccatgtcgacgtgctttgcgag
gctcaacctgtcgaccccaaaaaactgctggggcaaaccctgacggtggagtgtcgccaa
accccgctgaccccaccacgctatttgtcgggcatcatgacgcgggttgaggtcaagggg
cgggacaaaaacgaccgctatgaccgctatacccttaccgtcaaacccgccttgtggtat
ctggggcagggacgggattgccggatatggcaagagaaaagcgtgccggacatcatcacc
acactcttgcgtgagcagaatattgcgtttgagaaccgcctgagctgggattaccggtgc
tgggagtactgcgtgcaatatcaggaaagcgacttcgattttatcagtcgcctgatggag
catgaaggtatctattactacttcctgcacgataacgggaaacacacgctggtgctggct
gatgcacccgagcagcacgaggtgctcagtggtttcgccaccttcccgtgtattgacgag
acggcgagtgatgtctccgagccggggattgcacactggcgggtgtccgagacgatgtcc
gcgtcgctgtatctgactgacgactatgattttcgccggccgcgtgccagcctgctgcag
gcgagacaaaatcccgcacctgacggccagcaagaggctgtcgtgtttgactggccgggg
cggtatacccggcatgatgacggggcattttacggtcgaattcgccagcaggagcttgcg
tgtgcacaggcacagatgtcgggggaaaccccgtcgctgggcatggcaccagggcatgcc
tttaccctgacgcgggcggcgcgcccggaagataaccggacctatatcgtcagcggtgca
gagtattttttcagtgaggccggttattacagtcaggatgacgaagaggcgacaccggta
catcgcacggtctttaccgcccacccggcggccctgagctggcgtccagcccggcaaact
gcctggccgcggacatacggcccgcaaacagcggaggtggtggggccacaggggcagacc
atctggaccgatgaatacgggcgcatcaaactcaggttccgttgggaccgccataacgcc
cccggtaatgaccaggcagcctgctgggtgcgtgtgtccagtgcctgggccggatggggg
tatggcagtatccaggtaccccgtgtcggcgaagaggttatcgtcgactttatcaacggt
gacccggaccgccccatcgtcaccggccgcgtgtataaccaggacagcatgccgccgtgg
gatttgccggcggatgcgaccaaaatgggcttcatgacgcgttctgcgggcggaaccccc
gagaacggcagctttttggtgtttgacgatgcaccggggcgtgagacgtttgacatgcac
gccgaacgtgacatgagcatgagcactgaacgtgacctgacggtgaatatcgagggggca
cggaccacgcgggtgaagggcaaagacagctacacgttcgatgacagccagcgtgtacgt
atcgccagggggcggcaggttgatatcgcggcgggtggtgataaccgagaggtcacgggg
gacagcacgaccactttgcacggcaagcagacggttatcattgacggcgagttggttgag
gaataccgggacgggcaaacaaccacagtcaccgccggtggccagacgctaaagatacac
gccggtggccaaacgataatcatcagcgaggggggccggtccattgacatcgtcggggat
gcaaaaaaaaagataaccggcaacgagcgcgaggacacgacgggggaatggacgaagtca
gtgggtggtaccattaacatcctgtccgatgcggatgtgaacattaaaagcgccacgaaa
atcacgatggatgcgcccaatcaaaaggctactaccggcaaggggcacagcgaaagcttt
accggtcactctttcagcatgacgggtgcatcggaaagctttaccggcagttcggtcagt
tttaccaactcatcggtcagttttacggcgtcgagtgtttcgatgggcatgttctccatc
agtaacacgccgtttaaattatcaaaacatgataaccatcttgaatttgtcagcggtaat
aaaacgctcaccagcactcttctctctctcaagagtgattacagtgcgtttgtgagcgcc
ctgacgacgattgcgtga

DBGET integrated database retrieval system