KEGG   Serratia marcescens WW4: SMWW4_v1c07090Help
Entry
SMWW4_v1c07090    CDS       T02448                                 

Gene name
apaG
Definition
(GenBank) protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SMWW4_v1c07090 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AGE16516
Position
complement(789810..790187)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCIQVQSIYVESQSIPEEERYVFAYTITIRNLGRTNVQLLGRYWLITNSNGRQT
EVQGEGVIGEQPVIPPGGEFQYTSGAILETPLGTMEGHYEMVDHQGQPFRTAIPVFRLAI
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtgtgtattcaggttcagagcatctatgtggaatcacagtcg
atccctgaagaagagcgttacgtcttcgcctataccatcaccatccgcaatctggggcgg
accaacgtgcaactgctgggccgttactggctgatcaccaacagcaacggccgccaaacc
gaagtccagggcgaaggcgtgatcggcgaacagcccgtcattccgcccggcggagagttt
cagtacaccagcggcgccattctggaaacgccgctgggcaccatggaaggccattacgaa
atggttgaccatcagggtcagccgttccgcaccgctattcccgtgtttcgcttagccatt
ccaacgctgatccattaa

DBGET integrated database retrieval system