KEGG   Serratia marcescens WW4: SMWW4_v1c24690Help
Entry
SMWW4_v1c24690    CDS       T02448                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
smw  Serratia marcescens WW4
Pathway
smw00061  Fatty acid biosynthesis
smw00071  Fatty acid degradation
smw01100  Metabolic pathways
smw01212  Fatty acid metabolism
smw02024  Quorum sensing
Module
smw_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SMWW4_v1c24690
   00071 Fatty acid degradation
    SMWW4_v1c24690
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SMWW4_v1c24690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:smw01004]
    SMWW4_v1c24690
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smw04147]
    SMWW4_v1c24690
Enzymes [BR:smw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     SMWW4_v1c24690
Lipid biosynthesis proteins [BR:smw01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   SMWW4_v1c24690
Exosome [BR:smw04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   SMWW4_v1c24690
  Exosomal proteins of breast cancer cells
   SMWW4_v1c24690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGE18266
Position
complement(2672394..2673932)
Genome map
AA seq 512 aa AA seqDB search
MLNLATLLEESARTWPERPAVIQDDIPLSYRALNEMANRVANLLVARGVQPGERVALACT
NRPEFPAIYYGILKSGAVVVPLNILLKSAEFDYYLADSAAVALFCFEGSSTLPLGEEALR
AAAKAEQCREVFIIGDRLPLEGERFSQAIAAQSTEFASAATLESDTAVVLYTSGTTGRAK
GAELTHANLVLNALGSVRLFDGSEANPDRHLVTLPLFHTFGSTVQMNAGFAAAATLVLVE
RFDAAQAIALMQRHGITFFAGVPTMYWALLNALDEHTDIERLRSTLRMAVSGGASLPVQI
LEDFSRRFGVNILEGYGLSETSPVATFNHPHRVTKPGSIGQPIWGVEVRLLDVTGQPIDG
VDQVGEIAVRGYNIMKGYLNRPEATAEVLENGWFRTGDLARRDADGFYFIVDRAKDMIIR
GGFNVYPREIEEALIRHPAVSLVAVIGVEHPSLGEEIKAVVVLKETEEPIEEEALIAWSR
ERLAAFKYPRIVEFVERLPMTSTGKVLKRCLR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatctggcaaccttgcttgaagagagtgcgcgtacctggccggagcggccggcg
gtgatacaggacgatatcccgctcagctatcgggcgctgaatgaaatggccaaccgggtg
gcgaatttgctggtcgcgcgcggcgtgcagcccggtgaacgggtggcgctggcctgcaca
aaccggccggagtttccggctatctactacggcatcctcaaaagcggcgccgtggtggtg
ccgctgaatattttgcttaaaagcgccgaattcgactattacctggcggattcggcggcg
gtggcgctgttctgtttcgaaggcagcagcactctgccgttgggggaagaggcactgcgg
gcggcggcgaaggcggaacaatgccgcgaggtgtttattatcggcgatcggctgccgctc
gagggggagcgtttcagccaggcgatagccgcacagtccactgagttcgcgtctgccgcg
acgctcgaaagcgacacggcggtggtgctctataccagcggcaccaccggccgggccaag
ggtgcggagttgacccacgccaatctggtgctcaacgcattgggatcggtgcggctgttc
gacggctcagaggcgaatcccgatcgtcacctggtaaccttgccgctgttccacacgttt
ggttcgacggtgcagatgaacgccggatttgccgccgccgccaccctggtgctggtcgag
cgcttcgacgccgcacaggccatcgcgctgatgcaacggcacggcatcacctttttcgcc
ggggtgccgaccatgtattgggcgctgttgaatgcgctggatgagcacacggatatcgaa
cgcttgcgcagcacgctgcgtatggcggtgtccggcggcgccagcctgccggtgcagatc
ctggaggatttctcgcgccgcttcggcgtcaacattctcgaagggtatgggctgtcggaa
accagtccggtcgccacctttaaccatccgcaccgcgtgaccaaacccggctccatcggc
caaccgatctggggcgtggaggttcgcttgctcgacgtcaccgggcagccgatcgacggt
gtcgatcaggtgggggagatcgcggtgcgcggttacaacatcatgaaaggctatctgaat
cgccccgaagcgacggcggaggtgctggaaaacggctggtttcgcaccggcgatctggcg
cgccgcgacgccgacggcttctattttatcgtcgatcgagccaaggacatgatcattcgc
ggcgggttcaacgtctatccgcgcgagattgaagaggcgctgattcgccatccggcggtg
tcgttggtggcggtgatcggtgtcgagcatccttcgctgggcgaagagatcaaagcggtg
gtggtattgaaggaaacggaagaaccgatcgaggaagaagcgctgatcgcctggagccgg
gagcggctggcggcgttcaagtatccgcgtatcgtcgagtttgtcgaacgcttgccgatg
accagtaccggtaaggtgttgaaacgctgtttgcgctga

DBGET integrated database retrieval system