KEGG   Serratia marcescens WW4: SMWW4_v1c28970Help
Entry
SMWW4_v1c28970    CDS       T02448                                 

Definition
(GenBank) UDP-N-acetylglucosamine 4-epimerase
  KO
K19997  GlcNAc-P-P-Und epimerase [EC:5.1.3.26]
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMWW4_v1c28970
Enzymes [BR:smw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.26  N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase
     SMWW4_v1c28970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 NAD_binding_10 Polysacc_synt_2 TrkA_N Semialdhyde_dh Sacchrp_dh_NADP DapB_N F420_oxidored 2-Hacid_dh_C CIF
Motif
Other DBs
NCBI-ProteinID: AGE18691
Position
complement(3133047..3134009)
Genome map
AA seq 320 aa AA seqDB search
MDKRKVAIIGGSGFIGTRLAKRLSKRDDLTLVIVDKQPSAHFPSLYQYGDVTQPQTLQEP
LAGCDAIINLAAEHQDNVDPISLYYQVNVEGARHVCMTASALNIRQIIFTSSVAVYGFVK
QETGEEGRFEPFNHYGKSKLEAEYVYEAWRKADEENRLTIIRPTVVFGEGNRGNVYNLFR
QIASGRFVMIGSGNNMKSMAYVENIAARLEYALDQQSSYQVSNYVDKPDFTMNQLVDVIS
SSLGRENKTIRIPYAVGICGATALDVVSKISRKKFPISRVRVQKFCARTQFKSNVKNNFV
APVELDSAIERTIKHEFSDR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggataagcgtaaagtagctattatcgggggttccggttttatcggaacacgcctggct
aagcgtctcagtaagcgcgatgatctgacattggtcatcgtcgataagcaacccagtgca
cattttccatccctttatcagtatggcgatgtgacgcaaccccagaccttgcaagaaccg
ctggcgggctgcgacgccatcattaatctggcggcggagcatcaggacaatgtcgatcct
atttcgctctattatcaggtcaatgtcgaaggcgcgcgccatgtctgcatgaccgcctcc
gccctgaatatccgtcaaatcattttcacctcctcggtcgctgtttacggcttcgtcaaa
caggagaccggcgaagaaggacgtttcgagcctttcaaccattacggcaaatccaagctc
gaggcggaatacgtttatgaagcctggcgcaaggccgatgaggaaaatcggttgactatc
atccgcccaacggtggtattcggcgaaggcaaccgtggcaatgtgtataacctgttccgt
cagatcgccagcggacgtttcgtgatgattggcagcggcaataatatgaagtcgatggcc
tacgttgaaaatattgccgcgcggctggaatatgcactggatcaacagtcaagttatcag
gtcagcaactacgtcgataaaccggactttacgatgaatcaattggttgacgtaatttcc
tcttcattggggagagaaaataagacgattcgcattccttatgccgtaggcatatgcggc
gcaaccgcattggatgttgtgagtaaaataagtcgaaagaaattcccaatcagtcgtgtc
agagtacagaaattctgcgccagaacgcagtttaaaagtaatgtgaaaaataatttcgtg
gcgcctgttgaacttgattcggcaatcgaaagaaccattaaacatgagttttctgataga
taa

DBGET integrated database retrieval system