KEGG   Serratia marcescens WW4: SMWW4_v1c30000
Entry
SMWW4_v1c30000    CDS       T02448                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30000
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30000
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AGE18794
Position
3235473..3237812
AA seq 779 aa
MDRLIIAHTPLPANQLLFRSLSGEEKLAGLFEFDVELLSPDNRLDLKALLGQKITLELRG
NPLAPRYLNGNITRMTLSGREAGGNRYYIYRAVLRPTLWYLTQNRDFRIYQEQTVPDILT
QVLGQYQVKIDNRLSYDYRIWGYCVQYQESDFDFISRLMEHEGIYYYFTHQQDGHTLVLA
DAPAAHQELAGYASIPYQLAEGGLVENKDSINSWSVSDAITPSLYSLDDYDFRKPRARLL
EARQNPASFAQDKAEVFDWPGRYTDHAHGQFYVKVRQQEFEAQHEQMSGEGNSQGIAPGY
RFQLTQAPRMEDNRTYLVVSAHYFMQENSYTSNDNDVGEQRTEFQVVPADINWRPARTTP
WPKTHGPQTAEVVGPEGESIWTDKYGRVKLKFRWDRHGSGNETSSCWVRVSSAWAGWKYG
GIQIPRVGEEVVVDFINGDPDRPIITGRVYNEDSMPPWDLPGDATKMGFMSRSKGGGVDN
ASFLFLEDSPGNESFDMHAERNMNMTVENDKNVNIDGSRTTTIGRQQDDTVTGDATFLYK
AKRTTTVNGLETANLNAHQTVNIKGGRDLTIIDGGDKIDITGNQSFKLDGAQTQNITQTQ
HVTVKGNQTLDITEGQQTSTIKQGQTVNITSGGQHTTITAGGQELTIKGGGQTATVTGDV
TETYKNDQSTTITGTLTIKAKTINITSADGVSVQTPSWKDNCHGLKWVATGANFAFYGSN
LALTGASLKHTMLDISHNPLSISKTNFKLSNDPMTFTQLGALVTNGALRLSTKALAIFL
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggatcgccttatcattgcgcacacgcctttgcccgccaatcagctgttgttcagaagc
ctttccggtgaggaaaaactggccggcctgttcgaattcgacgtcgagctgctcagcccc
gacaatcggctcgatctgaaagcgctgctgggacaaaaaatcacgctggaactgcggggc
aatccgttggcgccgcgttatctcaacggcaatatcacgcgcatgaccctctccggacga
gaagccggcggcaaccgttactatatctaccgcgccgtgctgcgccccacgctgtggtat
ctgacgcaaaaccgcgattttcgcatctaccaggaacagaccgttcccgacatcctgact
caggtgctggggcagtatcaggtgaagatcgataaccgcctgagttacgactaccgcatc
tgggggtactgcgtgcagtaccaggagagcgatttcgatttcatcagccgcctgatggaa
cacgaaggcatctattattatttcacgcaccagcaagacggccatacgctggtgctggct
gacgcgccggcggcccatcaggaactcgccggctacgccagcattccctatcagctcgcg
gaaggcggcctggtggaaaacaaagacagcatcaacagctggagcgtttctgacgccatc
acgcccagcctgtatagcctggatgactacgattttcgcaagccgcgcgcgcggttgctg
gaggcccggcaaaatcccgcctcattcgcgcaggacaaagcagaggtgttcgactggccc
ggccgttataccgatcacgcccatggccagttttacgtcaaggttcgccaacaggagttc
gaagcgcagcatgagcagatgagcggcgaaggcaattcgcagggcattgcgcccggctat
cgttttcaactgacccaggcgccgcgtatggaagacaaccgcacctacctggtggtcagc
gcacattacttcatgcaggagaacagctacaccagcaacgataacgatgtcggcgaacag
cgaaccgaatttcaggtcgttccggcggatatcaattggcgcccggcgcgcaccacgccc
tggccgaaaacccatggcccgcaaactgccgaagtggtgggcccggaaggcgaaagcatc
tggaccgataaatatggccgggtgaaactcaaattccgttgggatcgccacggcagcggc
aacgaaaccagctcctgctgggtgcgcgtctccagcgcctgggccggctggaaatacggc
gggatccagatcccgcgcgtcggtgaggaagtggtggtcgactttatcaacggcgatccg
gatcgccccatcatcaccggccgcgtttacaacgaagacagcatgccaccgtgggatctg
cccggcgacgccaccaaaatgggctttatgagccgcagcaaaggcggcggcgtcgacaac
gccagcttcctgttcctggaagactcgcccggcaacgaatctttcgacatgcacgccgaa
cgcaacatgaacatgacggtggagaacgacaagaacgtcaatattgacggcagtcgcacc
accaccatcggtcgccagcaggacgacaccgtcaccggcgacgccacgttcctgtacaaa
gcgaaacgcaccacaacggtcaatgggctggaaaccgccaacctgaacgctcaccagacg
gtgaacatcaaaggcggccgcgacctgacgattatcgacggtggcgataaaatcgacatc
accggcaatcagtccttcaagctcgacggcgcgcagacgcaaaacattacgcaaacccag
catgtcacggtgaaaggcaaccagaccctcgacattaccgaggggcaacaaaccagcacc
atcaagcaagggcagacggtcaacatcacctccggcgggcagcacaccaccatcaccgcc
ggcgggcaggaattgacgattaaaggcggcggccaaaccgccaccgtaaccggggatgtc
accgagacctacaaaaacgatcagagcaccacgatcaccggcacgctgaccatcaaggcg
aaaacgatcaatatcaccagcgcggacggcgtatcggtgcagacaccgagctggaaagat
aactgccacggcttgaaatgggtggcgaccggggccaacttcgccttttacggttcaaat
cttgcgttgacaggagccagcctgaaacacacgatgctggatatctcgcacaacccgctg
tcgatcagcaaaaccaatttcaagctcagtaatgatcccatgacgttcacgcagcttggc
gcgctggtgaccaacggtgccttacgattgagcaccaaggcgctggcgatcttcttgtaa

DBGET integrated database retrieval system