KEGG   Serratia marcescens WW4: SMWW4_v1c30080
Entry
SMWW4_v1c30080    CDS       T02448                                 

Gene name
vasD
Definition
(GenBank) type VI secretion system protein VasD
  KO
K11906  type VI secretion system protein VasD
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30080 (vasD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30080 (vasD)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30080 (vasD)
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AGE18802
Structure
PDB: 
4A1R

Position
3244255..3244785
AA seq 176 aa
MMTTPIASRWCGMLFLLLGALALGGCMSSAKSVPSRYSLVFDADRQVNAAAGAQPAPIKI
RVLLLRSDAEFMDADFFSLQNDAKSVLGNSLLDSDQFFLTPGQTGKTLGGQSALDARYIG
VIAEYQNLDGKAWRISLPLPEPTETNFYKVWQFSPDELEAHIVAGVNGLRPVKKVD
NT seq 531 nt   +upstreamnt  +downstreamnt
atgatgacgacccctatcgcttcccgctggtgcgggatgctgtttctgctgctgggcgcg
ttggcgctcggcggttgcatgtcttccgccaaaagcgtgccgtcgcgctacagcctggtg
ttcgatgccgatcgccaggtcaacgccgccgccggcgcgcaaccggcgccgataaaaatt
cgcgtgctgctgctgcgttcggatgcggaattcatggatgccgacttcttcagtctgcaa
aacgacgccaaaagcgtgctcggcaatagcctgctggacagcgatcagttcttcctgacg
ccgggccagaccggcaagacgctcggcgggcaaagcgcattggacgcacgttacatcggc
gtgatcgccgagtatcaaaacctggacggcaaggcctggcgcatttcgctgccgctgccg
gagcccaccgaaaccaatttctacaaggtatggcaattctcgccggatgagctggaagcg
catatcgtcgcgggcgtgaatggcctgcgccccgtaaaaaaggtcgactga

DBGET integrated database retrieval system