KEGG   Serratia marcescens WW4: SMWW4_v1c30090
Entry
SMWW4_v1c30090    CDS       T02448                                 

Gene name
impJ
Definition
(GenBank) type VI secretion system protein ImpJ
  KO
K11893  type VI secretion system protein ImpJ
Organism
smw  Serratia marcescens WW4
Brite
KEGG Orthology (KO) [BR:smw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30090 (impJ)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30090 (impJ)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AGE18803
Position
3244826..3246172
AA seq 448 aa
MKDAHKVVWTEGMFLRPHHFQQAENYLEGYMRNWGQAHSGCFWGFLTLDLDQTLLRQGKI
ALNAASGIMPDGTPFRFAGAQQAPAPLSIAENKTGENVVLALPTYRAGREDVIFQESPEA
LARYLAYENEVDDLNAVSVGSAALQFGRLRLRLMLESELNAEWTALGVTRVLEKRGDNSL
RLDTAQIPPMLNCQGNPVLKTFINDLQGLLQQRSQQMSQRLLQPGRGGSSEMVDFMLLQL
INRHLGQVSHAYHLDHLHPERLFADWLQFATELASFSAQRTPEGRLPVYDHDNLALCFGK
LMLLLRQGLSVVLEDNAIQLTLVERSHGLNVATVQDTKMMRDFGFVLAVRADVAAEVLLT
HFPAQMKIAPVTRIRDLVQLQLPGIGLRTMPVAPRQIPYHAGYTYFELEKGGDLWKQMEK
SSAFALHLAGEFPGLDMEFWAIRSHTDR
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaaagatgctcataaggttgtctggactgaggggatgtttttacgccctcaccatttc
cagcaggcggaaaactatctcgaaggctatatgcgcaactggggccaggcccacagcggc
tgtttctgggggttcctgaccctggatctggaccaaacgctgctgcgccagggcaagatt
gcgctcaacgccgccagcggcatcatgccggacggcacgccgtttcgctttgccggtgcc
cagcaggcgcccgcgccgctgagcatcgccgaaaacaagaccggtgaaaacgtggtgctg
gccctgccgacttaccgcgcagggcgtgaagacgtgatctttcaggaaagcccggaagcg
ctggcgcgctatctggcctacgagaacgaagtcgacgatctcaacgccgtctcggtgggc
agcgcggcgctgcagttcggccgcctgcgcctgcggctgatgctggagagcgagctgaac
gccgaatggacggcgctcggcgtcacccgcgtgctggaaaagcgcggcgacaacagcctg
cgtctcgatacggcgcaaatcccgccgatgctgaactgtcagggcaacccggtactgaag
accttcatcaacgatctgcagggcctgctgcaacagcgcagccagcagatgagtcaacgc
ctgctgcagccgggccgcggcggcagttccgaaatggtcgatttcatgctgctgcagctg
atcaaccgccatctcggtcaggtgagccatgcctaccacctcgaccatctgcacccggag
cgcctgttcgccgattggctgcagttcgccaccgaactcgccagcttctcggcgcagcgc
accccggaaggccgcctgccggtgtacgaccacgacaacctggcgctgtgcttcggtaag
ctgatgctgttgctgcgtcaaggattgtcagtggtgctggaagacaacgccattcagctg
acgctggtcgaacgatcccacgggttgaacgtcgccaccgtgcaggacaccaaaatgatg
cgcgacttcggtttcgtcttggcagtgcgcgccgacgtggccgccgaggtgttgctgacc
cacttcccggcgcaaatgaagatcgccccggtcacgcgcatccgcgatctggtgcagctg
cagctgccgggcatcggtctgcgcaccatgcccgtcgcgccgcgccagatcccttatcac
gccggctatacctatttcgagctggaaaaaggcggcgacctgtggaaacagatggaaaaa
tccagcgccttcgccctgcacctggccggcgaattcccggggctggacatggaattttgg
gcgattcgcagccatacggaccggtaa

DBGET integrated database retrieval system