KEGG   Serratia marcescens WW4: SMWW4_v1c30100
Entry
SMWW4_v1c30100    CDS       T02448                                 

Gene name
impK
Definition
(GenBank) type VI secretion system protein ImpK
  KO
K11892  type VI secretion system protein ImpK
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30100 (impK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30100 (impK)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30100 (impK)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AGE18804
Position
3246194..3247396
AA seq 400 aa
MAPGANPLVDAANPLLNAISQIRQSATHANPAQLRQQLIDEMRRFEIRGQRANLPYEVII
GARYCLCTALDEAAALTPWGSNSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQSPREHIN
LLELINYCLLLGFEGRYRVMENGRSQLETMKQRLLQLIRTVRGGYAPPLSPHALDLPVQQ
KLWRPLVPLWACVALTGFLASLLFIALNWRLGDNTSPVLAAIYQTNLPQVAIGNPAPAAP
PTLSLKSFLRKEIAEGLVVVRDEAQQSVVILKGDGLFDSAATTVRANYIPVIDRIAAAMN
GVSGKILVTGYSDNLPIRSARFASNWELSLARAEAVSARLQKHLANPQRVKAEGRGESNP
VAPNDNKVNRALNRRVEITLLVAPENTQAEINGLPQGTGK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcgccgggggccaatccgctggtggacgccgccaacccgctgctgaacgccatttcg
cagatccgccagtcggccacgcacgccaacccggcgcagctgcgccaacagctgatcgac
gaaatgcgccgcttcgagatccgcggccaacgcgccaatctgccgtacgaagtgatcatc
ggcgcgcgttattgcctgtgcaccgcgctggatgaagcggcggcgctgaccccgtggggc
agcaacagcgtgtggtccggcagcgggctgctggtgaccttccataacgaaacctggggc
ggcgaaaagtttttccagctgctggccaagctgtcgcagagtccgcgtgagcacatcaac
ctgctggaactgatcaattattgcctgctgctgggctttgaaggccgctatcgggtgatg
gaaaacggccgttctcagctggaaaccatgaaacagcgcttgctgcagctgatccggacg
gtgcgcggcggctacgcccctcccctgtcgcctcatgcgttggatctgccggtacagcaa
aaactgtggcgcccgctggtgccgctgtgggcctgcgtggcgctgaccggcttcctggct
tcgctgctgttcatcgccctcaactggcggctgggcgacaacaccagcccggtgctggcg
gcgatttaccaaaccaatctgccgcaggtggcgatcggtaacccggcgccggccgcgccg
ccgacgctgagcctgaaaagcttcctgcgcaaagagatcgccgaagggctggtggtggtg
cgcgacgaagcgcagcaaagcgtggtgatcctaaaaggcgacgggctgttcgactccgcc
gccaccacggtgcgcgccaactatatcccggtcatcgaccgcatcgccgccgccatgaac
ggcgtcagcggcaagatcctggtcaccggctacagcgacaacctgccgatccgcagcgcc
cgtttcgcctccaactgggagctgtcgctggcgcgcgccgaagcggtcagcgcccgcttg
caaaaacacctcgccaacccgcagcgggtcaaggccgagggccgcggcgagagcaacccc
gtcgcgccgaacgataacaaagtgaaccgcgcgttgaaccgccgggtagaaattacgctg
ttggtcgccccggaaaacacccaggcggaaatcaacggcttgccgcaaggaaccggaaag
taa

DBGET integrated database retrieval system