KEGG   Serratia marcescens WW4: SMWW4_v1c30110
Entry
SMWW4_v1c30110    CDS       T02448                                 

Gene name
impL
Definition
(GenBank) type VI secretion system protein ImpL
  KO
K11891  type VI secretion system protein ImpL
Organism
smw  Serratia marcescens WW4
Pathway
smw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMWW4_v1c30110 (impL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smw02044]
    SMWW4_v1c30110 (impL)
Secretion system [BR:smw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SMWW4_v1c30110 (impL)
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_28 ABC_trans_CmpB
Other DBs
NCBI-ProteinID: AGE18805
Position
3247396..3251031
AA seq 1211 aa
MLSTLFSIITSRLLWGFVGITALAFIIWMIGPLVAIGDYRPLEPELNRQIAIGVIYLIWF
LCRLIPRLYSAWFNSRLLSNLRAAETVPAEDGKPEVKQDDQLAQRFDEAAQLLKKARFAP
GQGDGKHRWMTRFSRQYLYQLPWYVIIGAPGAGKTTALVNSGLHFPLADRFGKSALRGVG
GTRNCDWWFTNDAVLLDTAGRYTTQESQREEDAGEWQSFVALLKKYRTRQPINGVMVTIS
VADLLSDSAEARAAQASALRKRLIELHEQLGIHFPVYVLVTKTDLLNGFMAYFGSFDKAQ
RDQIWGFTFPYERSRQPDFNLNAAFEQQYALLQQRLDAALPDTLLMEHDARQRAESYLFP
QEFAALRPLLGHYLEQVFATSSFETRFTPRGIYFTSGTQEGLPFDRVMGELNRYLQLPTA
NSGAQANAAWDSVGQETPIPAAKGQSFFLKETLESVIFQESGLAGSNRWWEYRNRALHWA
GYIALAVVLAVLAMLWFTSYGNNKAYLAEVAAKVPGVERQGQNLTQVGNGDMFSLLPFLN
SLLHLPDSQNFSLDDPPFTYRMGLFRGDQVGDAGNALYQKALKELLLPQVAQQIATTLRN
DNHGDADFSYEALKAYQMLYLPKQYDGKFLRAWVMLNLQRNLPQGSTQKQLQQIEWHLSQ
LLDAQIQASPYAKDEQLVAQAQAAINRAPLSQRVYGRLKRLLLKQTDIKPVSLVDLAGPQ
TELAFSRKSGKPVTDGVPGLFTSQGYWKAFNDNIDPVTDTLRKEDVWVLNSQTPEQKSAD
LTKTIRQLYMQDFISAWDELLGDIQLANIGNLTQRISSARLLSGNPSPMRNLLVNVSKNV
TLRDEKSDADSRSLLAKTEDRLNQNANRTLEALFTNRPANADGDVSAQPEQLVMAHFAPL
LELAQSQGEGNKAIPFDSVLKQVDELYSYLTAVQGAANSGMSAPPSDIIPRLQAESGRLP
VPFKQMLLSLAIGASSDTQRKEMENVKKRISFEVGSFCRQAIAGRYPLVARARQEVTPDD
LARMFAPNSGLMDSFFRDNLQGKVDTTRANWRFTPGVDGKTLPGGEGILRSFQQAQRIRD
AFFANGTATPSYRVTVRPVRMDNDILNLTLDIDGQLFKYSHGPQVPLVVSWPGTRNTNQV
HLQLALANGTTASLVTSGPWALNRLVDMAQSSGTGGLGRQATFNLDGHRVTLEFTPNSIR
NPFQLPAFSCP
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgctcagtacgttattctccatcatcaccagccgcctgctgtggggctttgtcggcatt
accgcgctggcgttcatcatctggatgatcggcccgctggtggccatcggcgactatcgc
ccgctggagccggaactcaaccgccagatcgccattggcgtcatctacctgatctggttc
ctgtgccgcctgatcccgcgcctctacagcgcctggttcaacagccgcctgctgagcaac
ctgcgcgccgccgaaacggtgccggcggaagacggcaagcccgaggttaaacaagacgat
cagctggcgcagcgcttcgacgaagcggcgcagctgctgaaaaaggcgcgcttcgcaccg
ggccagggcgacggcaaacaccgctggatgacccgctttagccgccaatacctgtaccaa
ctgccgtggtatgtgatcatcggcgcgcccggtgccggcaagaccaccgcgctggtcaat
tccggcctgcacttcccgctggcggatcgcttcggcaaatccgcgctgcgcggcgtgggc
ggcacccgcaactgcgactggtggtttaccaacgacgccgtgttgctcgacaccgccggc
cgctacaccacccaggaaagccagcgcgaagaagacgccggcgaatggcaaagcttcgtc
gcgctgctgaaaaaatatcgcacccgccagccaatcaacggcgtgatggtcaccatcagc
gtcgccgatctgctgagcgacagcgccgaagcgcgcgccgcccaggccagcgcgctgcgc
aaacgcctgatcgaactgcacgaacagctgggcattcacttcccggtctatgtgctggtg
accaaaaccgacctgctcaacggctttatggcctatttcggcagcttcgacaaagcgcag
cgcgaccagatctggggattcaccttcccttacgaacgctcgcggcagccggacttcaac
ctgaacgccgccttcgaacagcaatacgccctgctgcaacaacggctggatgcggcgctg
ccggatacgctgctgatggagcacgacgcgcgccaacgcgccgaaagctatctgttcccg
caggaattcgccgcgctgcgcccgctgctcggccactatctggaacaggtgttcgccacc
tccagttttgaaacccgctttaccccgcgcggcatctatttcaccagcggcacccaagag
gggctgccgttcgaccgggtgatgggcgaactgaaccgctacctgcagctgccgacggcc
aactcaggggcgcaggccaacgcggcctgggacagcgtgggccaggaaacgccgatcccg
gcagccaaaggccagagcttcttcctgaaagagacgctggaatcggtgatcttccaggag
tccgggctggcgggcagcaaccgctggtgggaataccgcaaccgcgccctgcactgggcg
ggttacatcgcgctggcggtggtcctggcggtgctggcgatgctctggttcaccagttac
ggcaacaacaaggcctacctggcggaagtggccgccaaggtgcccggcgtcgagcgccag
gggcaaaacctgacgcaggtgggcaacggcgacatgttctcgctgctgccgttcctcaac
agcctgctgcacctgccggacagccagaacttttcgctggacgatccgccgttcacttac
cgtatggggctgttccgcggcgatcaggtcggtgacgccggcaatgccctgtatcaaaaa
gcgctgaaagagctgctgctgccgcaggtggcgcaacagatcgccaccacgctgcgcaac
gataaccacggcgacgcggacttcagctatgaagctttgaaggcctatcagatgctgtat
ctgccgaagcagtacgacggcaaattcctgcgcgcctgggtgatgctcaacctgcagcgc
aacctgccgcagggcagcacccaaaaacagctgcagcagatcgaatggcacctgagccaa
ctgctggatgcgcagatccaggcctcgccctacgccaaagatgaacagctggtggcgcag
gcgcaggccgccatcaatcgggcgccgctgtcgcagcgcgtctatggccgcctcaagcgc
ttgctgctgaaacagaccgacatcaagccggtcagcctggtcgatttggccggcccgcag
accgagctggcgttcagccgcaaaagcggcaaaccggtcaccgacggcgtgccgggcctg
ttcacctcgcaagggtactggaaagcgttcaacgacaacatcgatccggtgaccgatacc
ctgcgcaaggaagacgtctgggtgttgaacagccagacgccggagcagaagagcgccgat
ttgaccaagaccatccgccagctgtacatgcaggatttcatcagcgcctgggatgagctg
ctgggggatatccaactggccaacatcggcaacctgacccaacgcatcagcagcgcgcgc
ctgctgtcaggcaacccgtcgccgatgcgcaacctgctggtcaacgtcagcaaaaacgtt
accctgcgcgacgagaaaagcgacgccgattcccgctcgctgctggccaaaaccgaagac
aggctgaatcaaaacgccaaccgcacgctggaggcgctgttcaccaaccggccggccaac
gccgacggcgacgtgtcggcccagccggaacagctggtgatggcgcacttcgcgccgctg
ctggagctggcgcaaagccagggcgaaggcaataaggcgatccctttcgacagcgtgctg
aaacaggtcgatgagctgtacagctacctgacggcggtgcaaggcgcggccaacagcggc
atgtcggcgccgccgagcgacatcatcccgcgcctgcaggccgagtccggccgcttgccg
gtgccgttcaaacagatgctgctgtcactggcgatcggcgccagcagcgacacccagcgc
aaagagatggagaacgtgaaaaagcgcatcagcttcgaggtcggcagcttctgccgccag
gcgatcgccgggcgttatccgctggtggcccgggcgcgccaggaagtgacgccggacgat
ttggcgcgcatgttcgcgccgaacagcgggctgatggacagcttcttccgcgacaacctg
cagggcaaggtcgacactacccgcgccaactggcgctttacccccggcgtggacggcaag
acgctgcccggcggcgaaggcatcttgcgttcgttccagcaggcgcagcgcatccgcgac
gccttcttcgccaacggtaccgcgacgccctcgtaccgcgtgaccgtgcggccggtgcgg
atggataacgacatcctcaacctgacgctggatatcgacgggcagctgttcaaatacagc
cacggtccgcaggtgccgctggtggtcagctggccgggcacccgcaataccaaccaggtg
catctgcagctggcgctggccaacggcaccaccgccagcctggtgaccagcgggccgtgg
gcgctgaaccgcctggtggatatggcgcagtcttcgggcaccggcggcctcggccgtcag
gcgacgttcaatctcgacggccaccgcgtcacgctggagttcacgcccaacagcattcgc
aatccgttccaactgccggccttctcgtgcccgtag

DBGET integrated database retrieval system